ELF(544 (oopxQtdMAs2DI99FQ#/''0l?.4lxH5sA2C(pS`2s@x;,$~f0O9ndDK5oqia>BZ*m)BJN9sIFIcTz"} 2,.8{8]|5`^ 0w[QQ-J7mB!.:z1UF }j`!>I)M UaBu;X/k@]6Km ?6JR]S% 85i@<G( (9<,R/o ?^E4 NiWib&O4WqZ `P[LnXQCP&zGx[=&"!71TC Byh8j L|@J5Hf 41e#6VEEuZ )Lg-|C~/%ABaXp>~4(<ggpqX<w3=31.*" rtAC  h7#~ 'cl $+6S79DH:v'+k-w*K`3vULy^M *lKd 3D$@JE4^K}h)L'WznjR%m  aS@X( /+O"&["|^,\5kMTkUJ)aH_VP:>]V=P.u e$M, p;Z8{gl0[6c  bj<v8{<=KSAp]_WQ}Y$)-s#Z&=nF#OT\>E o? 7NDr-G#N(!{yRkrn;Ot3-+Vt:I%oCbfye"%E!hG}AwIc 7c\'hvu+\2+r|:= _Y?VT0GU$ ;2;DYbvue~fmtFHd!q_*&{NLb x*_6\tM>xq,fFer w%giRj:dYY0y/ H1P.31z?GdWopELM}9<T6LRK7PA\w( L0RP +L Ve,HP l@D'C /PNq=sp 6liL 4EdM1N045<h ! g|Md HclA$:Df|- 6aL7ئH-  CeJ BI5< ),iI<O-\ >Dj$| ??'G(  Pw D2RP(` 46b . ^NحmX8$T x F Tf/ 9O9\1q, 04 3PvJ4Lh74?, \@8Nmt ~Tu p/ d TI8hDh@2 hNH|P_Dh<0:(SJ |$+ HV (!|s3 /0$8 D-M1PL< J( LAܡD5 %U< 9q006#H'DP;8HP(44E0R&n 0JDLHtChCxK3\'`Ox `OiW.t75$ P(/ $d H:|r R"OZ];XDX6D@C4;@@IaCX$  Tp 'l!\OE06Cp*  x\ ? !N,42 p4 PT`DlO,[hN@0(8TPR u'L IбH$ w  D\0K HimTL01"=p(P E0-4 * @u,@p;Xb( THB!+SL2P4 :Ar*\0Q$cDD 4M .tKLu4LLhDp"J#N~XQ$  ;HM-qB(DH8)D% 0X4 BS0y ly @ - '="F=H(Z5 8`vx";ī/U,D8&P "T| @8H$  x.t DGlk> PD_D,T?%TN1\O }&\0IPd D qLg#BJ DQ O=8K2*DxH4&mTA*0 `CQN8lRV32<3Ph/ P:Pb18[K} V<0=gM4w' :P: 8;hL\>|4 QDhd XF/R  "JTBLH2qL{H39j> D4l*d <L0%p54 AM7TE,2+ ' ,~7da/TL/d .0qD 0DT? DܶA\ p9T"dMPFD'loHk$"4 k d@HDM0,1l#|d$B,lD:\l<LMp%0|tL#0`EQp ;H| 58t GhX XS8(\03*{ +8 H.Lx0 d9L-t _T?) LHDK4.tsg M6=F̘,8tJdh \u  7 DeD|$]t|@A,T+t !@ lG?8<|TO({$9pHUBM0`Y$ B+=\FATnX'\a*l ~SdTp !HTd$ P@{t<| bHf )L d<`%>nXR0 Dk&r %4Pp,${h eQaX< (.8 ;$Cd-?!.@,7,_@ ,Eu(v,/  4H`hhTL x 1|KL 3<DO@90=0>K6d:  F(Dh P>h4 N |3m A% 0 hxDxHRxdD8vTq >$\\8KL |z<,n \78C@6 <g\HAStD$ KTp4W  C8\x TU' Jh5-t R-", Tn:@#0LB& 5OY x5Q aD+8 LQdaX<:p@;yLd( djF<L xAD<lf-4 P* t?@,Dg9LB(h HR l L4u8xD @4@A!\" @DC$Od,l<P. @80&p* t)t "R( 4c?( "$ L5<6`| p .FxCV<\, UC@,Vt -x D $[  p{ DX9|+t lh H*)z 0 6Xlܷ $ Rw(1 /@,tYE8`#HM. 0eR8@` aU\+X4Mpg8g L<'L`RTG44@uel9|O>bG9Q`D/!+{ j :68 %T<7 |}$@Gpz@x <l`~4 3 ,QC$81L 2@S 8 '9ChYty% tIG/B2R4dD0,%1L,8H"|(3@/HB#|h%8 (D$QbD#dIDPLD,8Z31p.tx+d!L TdG0g0!, d> A7U;XL&|Q`DEhq0[(L8fP]4l@ _Ru(T @HCBPK~7,H '  )M)@l AbhX  <f),$1 G  p<4 <3 G"#XI 0OD 9CL L/SdlV, SU\8' =h6I &t \  C8-4 p ThOp` 4LQ#,2,T Ą&`yLL+D> U4 p}$ )q (;\?yM,- Ltt)l ,BRTHx .FL<|5<P,w M}  80T% P @ >\YP{HlKT/Ԝe' R0v  (Pb`94Sؘ$ H|O O @1Hԩ@OD1Ț P5,( w,( $# D( M^ \BLOL+%< : xq`}8L\I o#PE'\ ?+8/JtHqC8,H +T >DYL @8$= IWP< =&< t{U} ]d LPILH{:lex4P+ 8 "0$XP_D4` ]( R\hoU6A 6 L3 &,?0ED3/"J4 <BtL4 ( @A'8c ~ d0'd3 F !X  P< <K D |] | 0p ) hxH' HO4\  )dsR$X'Bhsh9 >@/$hIF !4 D<,4D& b28uPU ( ?8#QbD% (i JL YAv5'\T@ZPRcD [B$?*(`P8w/OG8?RcD\e% a" }#91 HP<tWH*, @P X% , p+R7(NnA ܎89R<d*&,+<7 %*:7T. \ H؇iL8,T( Ee\EP{RP`Dd8% T|&# lxF!DUUdd "|}$ <1 ; "C<lE.9 4\LLXgKD8P"5 y rN=Pi| 38 % Xԣ R!$ 0fT5jtM\[(7$Z - ! { pU  - =G>(BPnPPs 5pmh' C <@Ni[8BJ0`N . (CT;k4} R   L 6_lR8 (0(&,\ Si8 t= G <  HZPu p+G q" s<PDkkAXxx)K85Xr+h VHEt`L#`tJ0<8]&SD$!p 5T SPMb( @: 0 8A T0/ =  0> \1; % 8!  `2( 4"L{ /IF 4DX>   F<h,, `Hxe\&TM x,  ,( H?,(U% P $6l 4G5!lpQhcD|<|*܏ ;(0(L)| !D ,S$` e CRP:|@ K=F0QbD,D >d&@* HL, >#$%  Cdh',D  @Act>Xj  k3P=Q- 2IЦ'9LR7XT!~ t c" |\aS3IR ! Dr8s@ d* J9B/#p e Ix S. H@N(,` OIH/$< 0Tt?BThFDU@H Y$80LL >UI0plLJ X oS9aG4n7_'h1ll8p`Ih(]T9Pj5LN0$'=Nh ^2$*3(m 0/\y ( } &tx,X ||`6>-> |% kX4+,< \8f\}l (8``XODJM ?+HP_D , \HdPFP!L2Tt2v4$'` P%l %F82DR{/ P( 4 4K qHRt?)#DZ>,D :|,Ա T#pA Ad ^R(a439,NULPL[LD _C 9@S0> <$ 7B/< h$t* K@Q8i@:lKa HdQx:d$ ` 4, DEL\KT0L)y | zOc,Ԭ 4F(& lNT.6,"he ` b)6$)' LTW F,2 RE2L DH8T | P 4LD0!*D($ +I hk|1Pa #hp!t @8 S2|67/DBI?\1O *xqMl 0N%  p Ԝ0G/X 2,*988EQ8_D0P:8tpGHU9A@Hx=,|$x W$W LS# 83XP<r u?"p <3 <T \ & #/TT:T`/$8nh+ jlw 8x QXbD dH ?,L\pH <\ _fini__cxa_finalize__deregister_frame_info__register_frame_info_Jv_RegisterClasses__db185_open__os_calloc__os_exists__os_openhandle__os_closehandle__db_openflags__os_free__os_set_errnomemset__db_fcntl_mutex_init__db_fcntl_mutex_lock__os_yieldfcntl64__os_get_syserr__db_syserr__os_posix_err__env_panic__db_fcntl_mutex_unlock__db_fcntl_mutex_destroy__bam_cmp__db_pgfmt__db_moff__bam_defcmp__bam_defpfx__bam_pgin__bam_mswap__db_byteswap__bam_pgout__db_metaswap__bam_ca_delete__memp_skip_curadj__ram_ca_delete__bam_ca_di__bam_curadj_log__dbc_newopd__bam_ca_dup__bam_ca_undodup__dbc_close__bam_ca_rsplit__bam_ca_split__bam_ca_undosplit__bamc_init__dbc_close_pp__dbc_count_pp__dbc_del_pp__dbc_dup_pp__dbc_get_pp__dbc_pget_pp__dbc_put_pp__ramc_del__ramc_get__ramc_put__bamc_refresh__db_unknown_type__memp_fget__memp_fput__lock_get__db_lget__db_lput__db_free__lock_downgrade__bamc_count__memp_dirty__bam_cdel_log__bam_adjust__bam_stkrel__bamc_dup__db_unknown_flag__bam_bulk_overflow__bam_bulk_duplicates__db_goff__db_duperr__bam_opd_exists__bam_iitem__db_ret__bam_split__bamc_rget__bam_search__db_retcopy__ram_getno__bam_rsearch__bam_stkgrow__lock_put__bam_ditem__bam_dpages__db_doff__bam_adjindx__db_ditem__bam_adj_logmemmove__bam_relink__bam_pupdate__bam_rsplit_log__db_pgerr__bam_relink_log__bam_pinsert__db_errx__bam_db_create__bam_set_bt_compare__bam_get_bt_minkey__ram_get_re_len__ram_get_re_pad__bam_db_close__bam_map_flags__bam_set_flags__db_mi_open__dbh_am_chk__db_ferr__ram_map_flags__ram_set_flags__os_strdup__bam_open__bam_read_root__bam_metachk__db_fchk__db_fcchk__db_cursor__memp_set_last_pgno__bam_new_file__db_log_page__db_pgout__fop_write__bam_new_subdb__db_new__bam_root_log__db_rec_repl__db_rec_toobig__db_space_err__db_pitem__bam_ritem__db_err__db_partsize__os_realloc__bam_repl_log__db_poff__bam_split_recover__bam_split_read__os_malloc__db_check_lsn__bam_copy__bam_total__bam_rsplit_recover__bam_rsplit_read__ua_memcpy__bam_adj_recover__bam_adj_read__bam_cadjust_recover__bam_cadjust_read__bam_cdel_recover__bam_cdel_read__bam_repl_recover__bam_repl_read__bam_root_recover__bam_root_read__bam_curadj_recover__bam_curadj_read__bam_rcuradj_recover__bam_rcuradj_read__db_cursor_int__ram_ca__bam_relink_recover__bam_relink_read__bam_merge_44_recover__bam_merge_44_read__bam_merge_recover__bam_merge_read__bam_pgno_recover__bam_pgno_read__bam_relink_43_recover__bam_relink_43_read__bam_reclaim__bam_traverse__db_reclaim_callback__bam_truncate__db_truncate_callback__ram_open__ram_append__bam_rcuradj_log__bam_nrecs__db_appnamefopen64__os_get_errno__ram_writeback__env_panic_msg__env_set_state__db_getfwrite__os_ufreefgetc__bam_get_root__bam_cadjust_log__bam_split_log__bam_stat__os_umalloc__memp_get_last_pgno__bam_stat_callback__bam_stat_print__db_msg__db_get_lorder__db_prflags__db_dl__db_dl_pct__db_global_values__bam_print_cursor__bam_key_range__db_traverse_big__bam_compact__txn_begin__db_free_truncate__txn_commit__txn_set_timeout__txn_abortstrlen__dbc_dup__bam_merge_log__bam_pgno_log__db_ovref__memp_alloc_freelist__lock_set_timeout__memp_free_freelist__bam_30_btreemeta__os_fileid__bam_31_btreemeta__bam_31_lbtree__db_31_offdup__dbreg_id_to_db__db_pageswap__txn_activekids__dbreg_lazy_id__log_check_page_lsn__log_put__bam_init_recover__db_add_recovery_int__ham_quick_delete__ham_get_meta__ham_del_pair__ham_release_meta__hamc_init__ham_item_init__ham_get_cpage__hamc_count__ham_replpair__hamc_update__hamc_dup__ham_item_prev__ham_item_last__ham_item_next__ham_item_first__ham_item__db_log2__ham_init_dbt__ham_add_el__ham_add_dup__ham_dirty_meta__ham_metagroup_log__ham_split_page__ham_call_hash__ham_dsearch__ham_dup_convert__ham_make_dup__ham_item_reset__ham_getindex__ham_next_cpage__ham_curadj_log__ham_get_clist__ham_lock_bucket__ham_insdel_read__ham_insdel_log__ham_newpage_read__ham_newpage_log__ham_splitdata_read__ham_splitdata_log__ham_replace_read__ham_replace_log__ham_copypage_read__ham_copypage_log__ham_metagroup_42_read__ham_metagroup_read__ham_groupalloc_42_read__ham_groupalloc_read__ham_groupalloc_log__ham_curadj_read__ham_chgpg_read__ham_chgpg_log__ham_init_recover__ham_insdel_recover__ham_newpage_recover__ham_splitdata_recover__ham_replace_recover__ham_copypage_recover__ham_metagroup_recover__ham_groupalloc_recover__ham_curadj_recover__ham_chgpg_recover__ham_pgin__ham_mswap__ham_pgout__db_unknown_path__ham_add_ovflpage__ham_copypair__ham_db_create__ham_get_h_ffactor__ham_set_h_compare__ham_get_h_nelem__ham_db_close__ham_open__ham_func4__ham_func5__ham_metachk__ham_new_file__ham_new_subdb__ham_insertpairmemcmp__db_coff__ham_verify_sorted_page__db_prpage__ham_sort_page__ham_dpair__ham_onpage_replace__memp_ftruncate__ham_metagroup_42_recover__ham_groupalloc_42_recover__ham_reclaim__ham_traverse__ham_truncate__ham_stat__ham_stat_print__ham_print_cursor__ham_30_hashmeta__ham_30_sizefix__db_lastpgno__os_seek__os_write__ham_31_hashmeta__ham_31_hash__ham_46_hashmeta__ham_46_hash__ham_vrfy_meta__db_vrfy_getpageinfo__db_vrfy_meta__db_vrfy_putpageinfo__db_salvage_markdone__ham_vrfy__db_vrfy_datapage__db_vrfy_childput__ham_vrfy_structure__db_vrfy_pgset_get__db_vrfy_pgset_inc__db_vrfy_struct_feedback__db_vrfy_childcursor__db_vrfy_ccset__db_vrfy_ovfl_structure__db_vrfy_duptype__bam_vrfy_subtree__db_vrfy_ccnext__db_vrfy_ccclose__ham_vrfy_hashing__ham_salvage__db_vrfy_inpitem__db_vrfy_prdbt__db_safe_goff__db_salvage_duptree__ham_meta2pgset__qam_position__qam_fprobe__qam_pitem__qam_add_log__qam_mvptr_log__qam_append__qam_fclose__qam_del_log__qam_delext_log__dbc_idup__dbc_del_primary__qam_fremove__qam_incfirst_log__qamc_dup__qamc_init__qam_truncate__qam_delete__qam_incfirst_read__qam_mvptr_read__qam_del_read__qam_add_read__qam_delext_read__qam_init_recover__qam_incfirst_recover__qam_mvptr_recover__qam_del_recover__qam_add_recover__qam_delext_recover__qam_mswap__qam_pgin_out__memp_fclose__memp_get_flags__memp_fcreate__memp_set_lsn_offset__memp_set_pgcookie__memp_get_ftype__memp_set_ftype__memp_set_clear_len__qam_exid__memp_set_fileid__memp_fopen__memp_set_flags__log_flush__qam_sync__memp_fsync__memp_sync_int__qam_gen_filelist__qam_extent_names__db_create_internal__db_openstrcpy__db_close__qam_nameop__db_rpath__os_dirliststrrchrstrncmp__ctype_b_locstrtoul__memp_nameop__fop_rename__fop_remove__os_dirfree__qam_db_create__qam_get_extentsize__qam_db_close__queue_pageinfo__db_prqueue__qam_remove__qam_rename__txn_remlock__txn_closeevent__qam_map_flags__qam_set_flags__qam_open__qam_set_ext_data__qam_metachk__qam_new_file__qam_stat__qam_stat_print__qam_31_qammeta__qam_32_qammeta__qam_vrfy_meta__qam_vrfy_data__qam_vrfy_structure__qam_vrfy_walkqueue__db_salvage_isdone__db_salvage__db_vrfy_common__qam_salvage__rep_bulk_marshal__rep_bulk_unmarshal__rep_control_marshal__rep_control_unmarshal__rep_egen_marshal__rep_egen_unmarshal__rep_fileinfo_marshal__rep_fileinfo_unmarshal__rep_grant_info_marshal__rep_grant_info_unmarshal__rep_logreq_marshal__rep_logreq_unmarshal__rep_newfile_marshal__rep_newfile_unmarshal__rep_update_marshal__rep_update_unmarshal__rep_vote_info_marshal__rep_vote_info_unmarshal__rep_update_req__log_get_stable_lsn__log_cursor__logc_get__logc_version__rep_send_message__logc_close__rep_print__memp_inmemlistdb_strerror__rep_page_req__rep_bulk_alloc__lock_id__rep_bulk_message__rep_send_throttle__rep_bulk_free__lock_id_free__rep_update_setup__rep_lockout_api__os_gettime__rep_client_dbinit__db_truncate__os_open__os_fsync__rep_closefiles__log_zero__log_name__os_unlink__rep_bulk_page__rep_page__db_put__db_del__rep_page_fail__fop_create__memp_get_pgcookie__dbc_get__rep_check_doreq__rep_pggap_req__rep_init_cleanup__rep_remove_init_file__env_mpool__rep_finfo_alloc__log_newfile__rep_reset_init__os_read__rep_elect__env_not_config__rep_lease_waittime__rep_lockout_apply__os_unique_id__rep_islease_granted__rep_write_egen__rep_send_vote__rep_elect_done__rep_resend_req__rep_vote1__rep_lease_refresh__rep_grow_sites__rep_vote2__rep_fire_event__rep_update_grant__rep_lease_table_alloc__env_alloc__env_alloc_free__rep_lease_grant__rep_lease_check__rep_log_backup__rep_lease_expire__rep_allreq__rep_log__rep_apply__rep_logready__rep_loggap_req__rep_bulk_log__log_rep_split__rep_logreq__rep_verify_match__rep_env_create__rep_env_destroy__rep_get_config__rep_set_config__rep_send_bulk__rep_start__rep_lockout_msg__rep_preclose__rep_write_gen__env_init_rec__dbreg_mark_restored__dbreg_invalidate_files__txn_recycle_id__memp_set_config__log_get_oldversion__log_set_version__db_remove__dbt_usercopy__dbt_userfree__db_set_flags__txn_recover__txn_getckp__txn_ckp_read__db_txnlist_init__txn_regop_read__db_txnlist_find__db_txnlist_add__txn_xa_regop_read__rep_process_txn__txn_restore_txn__db_txnlist_end__rep_get_limit__rep_set_limit__rep_set_nsites__rep_get_nsites__rep_set_priority__rep_get_priority__rep_set_timeout__rep_get_timeout__rep_get_request__rep_set_request__rep_set_transport__rep_get_clockskew__rep_set_clockskew__rep_flush__rep_sync__rep_process_message__rep_print_message__rep_msg_from_old__rep_new_master__rep_verify__rep_verify_fail__rep_verify_req__memp_sync__log_autoremove__txn_regop_42_read__lock_get_listqsort__db_dispatch__lock_vec__txn_child_read__txn_updateckp__dbc_del__log_rep_put__txn_openfiles__rep_open__mutex_alloc__rep_env_refresh__mutex_free__rep_env_close__dbreg_close_files__rep_stat_pp__rep_stat_print_pp__rep_stat_print__db_stat_print__mutex_print_debug_single__db_dlbytes__os_ctime__rep_msg_to_old__log_vtruncate__rep_noarchive__env_rep_enter__env_db_rep_exit__db_rep_enter__op_rep_enter__op_rep_exit__db_msgadd__db_msgadd_ap__repmgr_handle_event__log_is_outdated__db_apprec__repmgr_close__repmgr_add_remote_site__repmgr_get_ack_policy__repmgr_set_ack_policy__repmgr_set_local_site__repmgr_site_list__repmgr_start__repmgr_stat_pp__repmgr_stat_print_pp__db_vrfy_overflow__db_verify_pp__db_verify_internal__db_pr_callback__db_vrfy_dbinfo_create__env_setup__db_salvage_init__db_salvage_destroy__db_prfooter__db_vrfy_dbinfo_destroy__db_chk_meta__bam_vrfy__ram_vrfy_leaf__bam_vrfy_meta__bam_vrfy_structure__db_master_open__db_vrfy_pgset__bam_vrfy_itemorder__db_vrfy_pgset_next__bam_salvage__db_salvage_markneeded__db_prheader__db_salvage_getnext__bam_salvage_walkdupint__bam_meta2pgset__db_set_pagesize__dbc_put__db_prdbt__lock_vec_pp__lock_getlocker__lock_get_internal__lock_fix_list__lock_ohash__lock_set_timeout_internal__lock_printlock__lock_detect__lock_get_pp__lock_getlocker_int__lock_nomem__lock_expired__lock_expires__lock_put_pp__lock_promote__lock_locker_is_parent__lock_detect_pp__lock_failchk__db_failed__lock_freefamilylocker__lock_id_pp__db_idspace__lock_set_thread_id__lock_id_free_pp__lock_freelocker__lock_id_set__lock_addfamilylocker__lock_list_print__dbreg_get_nameputchar__lock_env_create__os_cpu_count__lock_env_destroy__lock_get_lk_conflicts__lock_set_lk_conflicts__lock_get_lk_detect__lock_set_lk_detect__lock_get_lk_max_locks__lock_set_lk_max_locks__lock_get_lk_max_lockers__lock_set_lk_max_lockers__lock_get_lk_max_objects__lock_set_lk_max_objects__lock_get_lk_partitions__lock_set_lk_partitions__lock_get_env_timeout__lock_set_env_timeout__lock_open__env_region_attach__env_region_detach__db_tablesize__db_hashinit__lock_env_refresh__lock_region_mutex_count__env_alloc_size__lock_stat_pp__mutex_set_wait_info__mutex_clear__lock_stat_print_pp__lock_stat_print__db_print_reginfolocaltimestrftime__db_prbytes__lock_inherit_timeout__lock_lhash__mutex_alloc_int__mutex_free_int__mut_failchk__mutex_alloc_pp__mutex_free_pp__mutex_lock_pp__mutex_unlock_pp__mutex_get_align__mutex_set_align__mutex_get_increment__mutex_set_increment__mutex_get_max__mutex_set_max__mutex_get_tas_spins__mutex_set_tas_spins__mutex_open__log_region_mutex_count__memp_region_mutex_count__txn_region_mutex_count__mutex_env_refresh__mutex_stat_pp__mutex_stat_print_pp__mutex_stat_print__mutex_print_debug_stats__crypto_region_init__crdel_metasub_read__crdel_metasub_log__crdel_inmem_create_read__crdel_inmem_create_log__crdel_inmem_rename_read__crdel_inmem_rename_log__crdel_inmem_remove_read__crdel_inmem_remove_log__crdel_init_recover__crdel_metasub_recover__crdel_inmem_create_recover__crdel_inmem_rename_recover__crdel_inmem_remove_recover__db_meta_setup__db_master_update__memp_set_cachesize__env_open__dbreg_setup__dbreg_new_idstrcmp__memp_get_fileid__db_check_txn__db_refresh__env_close__db_sync__dbc_destroy__db_join_close__dbreg_revoke_id__dbreg_teardown__dbreg_close_id__db_backup_name__txn_record_fname__dbc_secondary_get_pp__db_associate__db_secondary_close_pp__db_pget_pp__db_secondary_close__db_s_first__db_s_next__db_s_done__db_associate_foreign__db_addrem_read__db_addrem_log__db_big_read__db_big_log__db_ovref_read__db_ovref_log__db_relink_42_read__db_debug_read__db_debug_log__db_noop_read__db_noop_log__db_pg_alloc_42_read__db_pg_alloc_read__db_pg_alloc_log__db_pg_free_42_read__db_pg_free_read__db_pg_free_log__db_cksum_read__db_cksum_log__db_pg_freedata_42_read__db_pg_freedata_read__db_pg_freedata_log__db_pg_init_read__db_pg_init_log__db_pg_sort_read__db_pg_sort_log__db_init_recover__db_addrem_recover__db_big_recover__db_ovref_recover__db_debug_recover__db_noop_recover__db_pg_alloc_recover__db_pg_free_recover__db_cksum_recover__db_pg_freedata_recover__db_pg_init_recover__db_pg_sort_recover__db_isbigendian__db_byteorder__dbc_count__db_secondary_corrupt__dbc_pget__cdsgroup_begin__db_pgin__db_check_chksum__db_decrypt_pg__db_encrypt_and_checksum_pg__db_chksum__db_txnlist_update__db_add_recovery__db_txnlist_remove__db_txnlist_ckp__db_txnlist_gen__db_txnlist_lsnadd__db_txnlist_lsninit__db_txnlist_lsnget__db_txnlist_print__db_fnl__env_panic_set__db_unknown_error__db_errcall__db_errfilevsnprintf__os_strerrorfputsvfprintffputcfflushstderrstdout__db_dbtype_to_string__db_not_txn_env__db_txn_deadlock_err__txn_get_name__db_rdonly__db_getlongstrtol__db_getulong__db_associate_pp__db_txn_auto_resolve__db_close_pp__db_cursor_pp__db_del_pp__db_exists__db_fd_pp__mp_xxx_fh__db_get_pp__db_join_pp__db_join__db_key_range_pp__db_open_pp__db_txn_auto_init__db_remove_int__db_pget__db_put_pp__db_compact_pp__db_associate_foreign_pp__db_sync_pp__memp_get_freelist__memp_extend_freelist__db_freelist_pos__db_pg_truncate__db_lprintdb_env_create__db_xa_create__db_dump_pp__db_get_flags__db_get_open_flags__db_remove_pp__db_rename_pp__db_set_lorder__db_stat_pp__db_stat_print_pp__db_truncate_pp__db_upgrade_pp__db_mi_env__memp_get_cachesize__env_get_encrypt_flags__env_set_encrypt__env_get_errcall__env_set_errcall__env_get_errfile__env_set_errfile__env_get_errpfx__env_set_errpfx__env_set_alloc__env_set_msgcall__env_get_msgfile__env_set_msgfile__env_set_paniccall__fop_file_setup__fop_subdb_setup__db_new_file__dbreg_log_id__txn_lockevent__db_init_subdb__os_urealloc__db_loadme__os_id__db_dumptree__db_get_flags_fn__db_prnpage__db_lockmode_to_string__db_dump__db_pg_alloc_42_recover__db_pg_free_42_recover__db_pg_freedata_42_recover__db_relink_42_recover__env_dbremove_pp__fop_remove_setup__db_inmem_remove__fop_lock_handle__txn_remevent__db_rename_int__env_dbrename_pp__fop_dummy__fop_dbrename__env_fileid_reset_pp__env_lsn_reset_pp__db_print_fileid__dbreg_print_fname__db_upgrade__os_ioinfo__db_dbm_init__db_ndbm_close__db_ndbm_open__db_dbm_close__db_dbm_fetch__db_ndbm_fetch__db_dbm_firstkey__db_ndbm_firstkey__db_dbm_nextkey__db_ndbm_nextkey__db_dbm_delete__db_ndbm_delete__db_dbm_store__db_ndbm_store__db_ndbm_error__db_ndbm_clearerr__db_ndbm_rdonly__db_ndbm_dirfno__db_ndbm_pagfno__dbreg_teardown_int__dbreg_get_id__dbreg_add_dbentry__dbreg_assign_id__dbreg_id_to_fname__dbreg_revoke_id_int__dbreg_rem_dbentry__dbreg_log_close__dbreg_close_id_int__dbreg_close_file__dbreg_failchk__dbreg_register_log__dbreg_register_read__dbreg_init_recover__dbreg_register_recover__dbreg_do_open__dbreg_stat_print__dbreg_log_files__dbreg_fid_to_fname__env_alloc_init__env_alloc_overhead__env_alloc_print__env_read_db_configstrchrfgets__config_splitstrcasecmp__env_set_data_dir__env_set_intermediate_dir_mode__env_set_flags__log_set_config__log_set_lg_bsize__log_set_lg_filemode__log_set_lg_max__log_set_lg_regionmax__log_set_lg_dir__memp_set_mp_max_openfd__memp_set_mp_max_write__memp_set_mp_mmapsize__env_set_shm_key__env_set_tmp_dir__txn_set_tx_max__env_set_verbosestrsep__env_failchk_pp__txn_failchk__env_thread_init__env_thread_destroy__memp_unpin_buffers__env_thread_id_string__db_file_extend__db_file_multi_write__db_file_write__log_env_create__memp_env_create__txn_env_create__db_env_destroy__log_env_destroy__memp_env_destroy__txn_env_destroy__env_close_pp__memp_get_cache_max__log_get_lg_bsize__log_get_lg_dir__log_get_lg_filemode__log_get_lg_max__log_get_lg_regionmax__memp_get_mp_max_openfd__memp_get_mp_max_write__memp_get_mp_mmapsize__env_get_open_flags__txn_get_tx_max__txn_get_tx_timestamp__log_archive_pp__log_cursor_pp__log_file_pp__log_flush_pp__log_get_config__log_printf_capi__log_put_pp__log_stat_pp__log_stat_print_pp__memp_fcreate_pp__memp_register_pp__memp_stat_pp__memp_stat_print_pp__memp_sync_pp__memp_trickle_pp__env_open_pp__env_remove__memp_set_cache_max__txn_set_tx_timestamp__env_stat_print_pp__txn_begin_pp__txn_checkpoint_pp__txn_recover_pp__txn_stat_pp__txn_stat_print_pp__env_map_flags__env_fetch_flags__os_support_direct_io__os_abspathdb_version__os_support_db_register__os_support_replication__env_config__envreg_register__env_remove_env__env_attach__env_ref_increment__memp_open__memp_register__log_open__txn_open__txn_reset__env_turn_on__envreg_xunlock__envreg_unregister__env_turn_off__os_isroot__os_getenv__os_tmpdir__txn_preclose__txn_env_refresh__log_env_refresh__memp_env_refresh__env_ref_decrement__env_detach__log_backupstrncpy__env_openfiles__txn_checkpoint__txn_findlastckp__log_current_lsn__txn_ckp_42_recover__txn_regop_42_recover__fop_init_recover__txn_init_recover__env_struct_sig__memp_max_regions__os_attach__os_detach__os_fdlock__log_stat_print__memp_stat_print__txn_stat_print__db_print_fh__fop_create_read__fop_create_log__fop_remove_read__fop_remove_log__fop_write_read__fop_write_log__fop_rename_read__fop_rename_log__fop_rename_int_log__fop_rename_noundo_log__fop_file_remove_read__fop_file_remove_log__fop_create_recover__fop_remove_recover__fop_write_recover__fop_rename_recover__fop_rename_noundo_recover__fop_file_remove_recover__fop_read_meta__txn_remrem__ham_func2__ham_func3__ham_test__db_SHA1Init__db_SHA1Update__db_SHA1Final__db_derive_mac__db_hcreate__db_hsearch__db_hdestroy__log_check_sizes__log_set_config_int__log_findatol__log_valid__log_hdrswap__log_persistswap__log_get_cached_ckp_lsn__log_flush_int__log_inmem_lsnoff__log_inmem_newfile__log_inmem_copyin__log_inmem_chkspace__txn_getactive__log_inmem_copyoutgetcwdlog_compare__log_printf_pp__log_printf__os_io__log_get_flags__log_set_flags__txn_force_abort__db_zero_extend__db_mkpath__os_mkdir__memp_alloc__txn_oldest_reader__memp_bhwrite__memp_bh_freeze__memp_bh_thaw__memp_bhfree__memp_free__memp_bh_priority__memp_pgread__memp_pg__memp_fn__txn_remove_buffer__memp_mf_discard__memp_fget_pp__memp_get_bucket__memp_fns__memp_bh_settxn__memp_fclose_pp__memp_fopen_pp__memp_fput_pp__memp_fsync_pp__os_mapfile__os_unmapfile__memp_mf_sync__memp_resize__memp_get_config__os_rename__os_truncate__txn_add_buffer__memp_init__memp_stat_hash__memp_walk_files__os_abort__os_stack__os_get_errno_ret_zeroclock_gettimesysconfctime_r__os_fs_notzeroopendirreaddir64closedir__errno_locationfdatasyncshmgetshmctlshmatshmdtmunlockmunmapmmap64db_env_set_func_closedb_env_set_func_dirfreedb_env_set_func_dirlistdb_env_set_func_existsdb_env_set_func_freedb_env_set_func_fsyncdb_env_set_func_ftruncatedb_env_set_func_ioinfodb_env_set_func_mallocdb_env_set_func_file_mapdb_env_set_func_region_mapdb_env_set_func_preaddb_env_set_func_pwritedb_env_set_func_opendb_env_set_func_readdb_env_set_func_reallocdb_env_set_func_renamedb_env_set_func_seekdb_env_set_func_unlinkdb_env_set_func_writedb_env_set_func_yieldfchmodgetpidgetuidpread64pwrite64__os_physwritelseek64fstat64ftruncate64srandsched_yieldselect__seq_stat__seq_stat_print__db_get_seq_flags_fndb_sequence_create__db_SHA1Transform__txn_xa_begin__txn_recycle_log__txn_compensate_begin__txn_id__txn_prepare__txn_set_name__txn_continue__txn_doevents__txn_regop_log__txn_child_log__txn_discard_int__txn_xa_regop_log__txn_dref_fname__txn_ckp_42_read__txn_ckp_log__txn_recycle_read__txn_regop_recover__txn_ckp_recover__txn_child_recover__txn_xa_regop_recover__txn_recycle_recover__txn_map_gid__txn_get_prepared__txn_id_setdb_xa_switch__xa_get_txn__db_rmid_to_env__db_map_rmid__db_unmap_rmid__db_xid_to_txn__db_map_xid__db_unmap_xid__db_zero_fillraiselibc.so.0_edata__bss_start__bss_start____bss_end____end__libdb-4.7.so 08@HPX`px (08@HPXhpx (08@HPX`hpx (08@HX`hpx (08HP`hp (08HPX`hpx(08@HPX`hpx (08@HP`hpx$(,048<@DHT`lpD H L P T  X \ ` d h "l #p &t ,x 0| 3 4 5 7 8 9 ; ? @ E H U [ \ ^ a c i q                       $ ( , 0 4  8 < @ D H  L !P %T .X 2\ 3` 5d 6h Al Bp Et Px X| Y [ ` a i j s y z                                  $ ( ", ,0 /4 08 :< >@ GD JH PL RP XT bX c\ f` kd }h l p t x |                              )) * / @ F W X Z ] ^ _ b c$ e( f, i0 k4 s8 t< z@ ~D H L P T X \ ` d h l p t x |                          ! # * + - 2 5 :AEI S]^`b m$t(v,y0}48<@DHLPTX\`dhlptx|  ()*.23ABGK      !$%&'( )*+-. /$0(1,2044586<:@;D<H=L>P?TAXB\C`DdFhGlIpJtLxM|NOPQRSTVWXY[]_`bcdefghjklmnoprstuvwx yz{|} ~$(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|      " #$&(',(0)4*8+<,@-D/H0L1P3T7X8\9`:d;h<l=p>t?x@|ACDFGHIJKLMNOQRSTUVWZ\]^_bcdefghjklm nopqr s$t(u,v0w4x8z<{@|D}H~LPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|      $(,048<@ D!H"L#P%T&X'\(`)d*h-l.p1t2x3|456789:;<=>?@ABCDEFGIJKLMNOQRSTVWYZ[ \]^_` a$c(d,g0h4i8j<l@mDoHpLqPrTsXt\u`vdwhxlypzt{x||~  $(,048<@DHLPTX\`dhlptx|  $( , 0 4 8<@DHLPTX\`dh!l"p#t$x%|&'*+,-./023456789:;<=>?ABCDEFGHIJKLM NOPQR S$T(U,V0\4]8^<`@aDdHeLgPjTkXl\m`ndohplqprtuxv|wxyz{|}  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHL P T X \`dhlptx|"$'(),./013456789;<=>?@BCDFGH JKLMN O$P(Q,R0T4U8V<W@XDYHZL[P\T]X^\_``dahcldpetfxg|hijklnopqrsuvwxyz{|}~  $(,048<@DHLPTX\`dhlptx|         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t  x  |                    ! " # $ % ' ) + , - / 0 1 4 5 6 7 8 ; < = > ? @ C$ D( E, G0 H4 I8 J< K@ L -L-ƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8@-X@X0@0SH00S <09400S ( 0  hd\ v@-P@P0@0S @@400S$00S3/ v |x0H- @MG@0 4 8 <0 0 0 0$0 0K  0S$0K4 9 0S<0So S:S 0<0 00 0Sa 000S000s0S 02 3/00S 0 00 0 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 0KH-(M $ ( ,0 000 0H0S 0H00S 7?O 00 00000 0000S 0000L 0L0R 00 ^ 0(0S 0(0c0S 7?On00 0 6 000 0 $0R+01 (0R% 00S 000:S 00 0S $0S,0S 00 0 00 0 000 00 0 0S 0(0S 0(00S 7?O!000 0S 0L 0L0R 0H0S 0H00S 7?O0S 0  0KH- M  000 0H0S 0H00S 7?O00 00000 0000S 0000L 0L0R 00 H0(0S 0(00S 7?OX00 0 00 0R 00S 000:S 00 0S 0S00  00 0 0S0(0S 0(0 0S 7?O!000 0S0S 0L 0L0R 0H0S 0H00S 7?O 0  0KH-XM0 4 8 <0 0000 000 000S 0000S 00000 0H0S 0H0*0S 7?O00 00000 0000S 0000L 0L0R 00 i0(0S 0(00S 7?O00 0 A 00S9 00 0 0 40R2 01 80R,: 00R 00S 000:S 00 0S 4A0S 0!<0s00s 0!0S 0 0R 00 00 0 0S0(0S 0(0<0S 7?O[000 0S 0L 0L0R 0H0S 0H0!0S 7?O@0S< 000S8 0000S3 0081<S.0000S 0000H0S 0000H0 20S00 <,0K4 8 0$ $0S $00KH- M  $0 000 00 0 0K$^ 0S 0)000 0$  0s 0!00S0 0 000s0S 00 0 00 0  0 0s 0!0KH-`M8 < @ D0 8000 000 800S 8000S 8000 0 00 0H0S 0H00S 7?O00 00000 0000S 0000L 0L0R 00 0(0S 0(00S 7?O00 0 U 00$0 $0 @0RC$01 D0R? 00S 000:S 00 0S @0S,$00S*0(0S 0(00S 7?O00 < 0! 0S3 0S 0 0R 00  00 0 0S0(0S 0(00S 7?O`000 0S 0L 0L0Rx 0H0S 0H00S 7?OC0S? 800S; 8000S6 8081<S18000S 8000H0S 8000H0 20S80 00K@ <D 0[( (0S 0S(00 0KH-(M $ ( ,0 000 00 0H0S 0H00S 7?O 00 00000 0000S 0000L 0L0R y 0(0S 0(00S 7?O00 0 Q 000 0 (0R&01 $0R 00S 0001 0R 00S 000:S 00 0S (0S 00 0  0(0S 0(00S 7?O?00 0S&0 ,0s 0! 0S 0(0S 0(00S 7?O000 0S 0L 0L0R| 0H0S 0H00S 7?O0KH-XM0 4 8 0000 000 000S 0000S 00000 0H0S 0H00S 7?O00 00000 0000S 0000L 0L0R 00 Y0(0S 0(00S 7?O00 0 1 00S) 00 40R$ 00S 000:S 00 0S 4 0S 008  0S 0 0R 00 00 0 0S0(0S 0(0 0S 7?O[000 0S 0L 0L0R 0H0S 0H00S 7?O@0S< 000S8 0000S3 0081<S.0000S 0000H0S 0000H0 20S00 (0K48  0 0S 00KH-XM0 4 8 <0 0000 000 000S 0000S 00000 0H0S 0H00S 7?O00 00000 0000S 0000L 0L0R 00 o0(0S 0(00S 7?O00 0 G 00S? 00 0 0 40R8 00S 000:S 00 0S 40S#0S 0 0R 00 01 0R*0S 08  0<  0!0s00cs 0! 00 0 0S0(0S 0(00S 7?O^000 0S 0L 0L0R 0H0S 0H00S 7?OC0S? 000S; 0000S6 0081<S10000S 0000H0S 0000H0 20S000S 800, K4< 00000000$ $0S $00KH- M  $0 000 0H0S 0H00S 7?O00 00000 0000S 0000L 0L0R v0(0S 0(00S 7?O00 0 N 00SF 000 0 0R  00S 000:S 00 0S  0S 0  0!0s00s 0!0 $0R 00S 000:S 00 0S $0S0  00 0 0S0(0S 0(00S 7?O000 0S 0L 0L0R 0H0S 0H00S 7?O0KH-M4B@  000 00S 00  0S 0t0! !0!0 0! !0!0 0! !0!0 0! !0 !0 0h! !0!0 0L! !0!0 00! !0!0 0S0! !0  !0  $!0  (!0  ,!0  0!0  4!0  !0  !0  $!0p  (!0t  ,!0h  0!0L  4!0KP\xh\H-M 000 0$1 0 000 00S 0 0 0  0 $ 0(0S04 0( 040 00 0( 0, 0,0 0,0  0 02<S 020s0S 00@0 c081 0S 0000Y30s0 0Cs 0,0 0 0 081 0S00S 026S 00 0 081 0S 00S 026S 00 0 0KH-tMJ@h l p h00(0 (00,0 (0$000 h0040 40080 80S 8000<0 00 00 4000s0S9 h00 h00S S &40 401`K( 0h 0S`0Sh081 0S 40 `0K(  0S`0Sh00,(  , 80Ss <000s0So 40 h0 h00\K0 0Sa\0 \0(02<S (020s0S "00B0400000l0 h0 \ h000 0S;800 800S S !<0 <01`K( 0 0S%`0S$<0 `0K(  0S`0S h00,&   00@0 ,000s0S h081:S9 h0 h00h, f 0S00 (h081 0S"h081 0Sh0000Sh000S 40 04   h 04 0S00S@0 h0 h00@0 0S 0S081 0S l0S h0 h00lK\K0 0S\01SL00D0 00$0H0 D00S 0 D0 00HM D0  00 0S 0S00 D00S D00=000 0S 0S00 0SD00SD0 $ 0SU\0h 0S Oh0 \ h000  0SD80S 40 h0 h0040 0S/hE 0S*p0 &$"  80S@ 800L0 800$0P0 L00S 80 L0 800P L0  0 0 0S 0S 00 L00S L00800 0 0S 0S 00 0SL00SL0 $ h00T0 h00$0X0 T00S h0 T0 h00Xl$ T0  0$0 $0S 0S$00 T00S T00h\00$0 $0S 0S$00 0ST00ST0 $ 0S h00, 0=0K茀XH-M 000 00 0 0( 040R 0(0  |0KH-0M( , (000 0$00 (000 00S0 (0 (00| 0S 06010K0[S; (000 (002<S (0020s0S 00@0[00 (000(002<S (0020s0S 00<0[000R0[0C0K0 0 0010C1K00 0002<S 020s0S 00@0[P00000s0s0S 00 0 [1[R (000 (002<S (0020s0S 00@0[00 (000(002<S (0020s0S $00D0[000Rv0[00K000(0 (00 0S 0m000 S;0 0 00K0010C1K00 0002<S 020s0S 00@0[P00000s0s0S 00 0 [1[R 0[00K000S 000S00 0 000S0010s0001 0 ,0  (0 0 (00 0  0KH-8M( (00 0 0$00 (000 00 000s0S 6?O000S (& 0S>0,0 0 `(000 0 0 0R 0 (00$00 00S (0 0 (00n 0  00 0S(081 0S(0000S(000S 0 0   ( 0 0S 0 (0 (00 0S0 0 0 $ 0S0(0 (00( 0S(00S5 (000S0 (081<S+(000S (000H0S (000H0 20S(0 00  0 0S 00 00  000S?00 00 02<S  020s0S "00B0000 0000 02<S  020s0S "00B0 00000< w$0K0(, 40 0S 0$0S6?O 0 c0S ( 0S 00 B(04 $ 0S N(0^ 0S F00 $0K0( 40 0S 800 0 0S $0K0( 0 0S &( 4 0S ( + 0S (081 0S(00 0R9(000 (002<S (0020s0S 00@0(00 (000(002<S (0020s0S 00@0[000R 6?O 0 00 0 0S $0K0( 0] 0S (  0S(081 0S(00 0R(000 (002<S (0020s0S 00@0(00 (000(002<S (0020s0S 00@0[000R W00 0 0S $0K0( 0 0S5 Z( 0S0 S( 0SH(081 0S&(00 0R9(000 (002<S (0020s0S 00@0(00 (000(002<S (0020s0S 00@0[000R 6?O 0 00 0 0S $0K0( 0 0S (N 0S(081 0S(00 0R(000 (002<S (0020s0S 00@0(00 (000(002<S (0020s0S 00@0[000R 00 $0K0(, 40; 0S 00 $0K0(, 40- 0S0!001R/ (000 (000(002<S (0020s0S 00@0((P00000s0s0S<( b 0S6 K00104 \ A*(&$"  0S 0S ( 000s0S 0 0R01![R 00 0 0KdiXH-XMP P< 0S 0*H0KP0S" P00 0 H 0 0P 0S 0 00, 0( KD0K 00[ 0000P0 P000S<P0T0 $0S \0  0C\0 \0  0C\0 \0X0 T0 $0S \000\K`KdKH h@ ,4 40S 4 6?OR d00 0d0 \ X0R\00\0 ]40P000SBP0T0 T000 d0 RLT0T0 `0h4 40S 40jd 00cd0 $0S \0  0C\0 \0  0C\0 00S \0<  0C\0 \0` @  b 0C\0 ` 00`0 \0  0C\0 (0Sh `00 018 0c0 d 0RK* [ 0R 0s0 [0c0Kho4 40S 4 6?OR 40<010K<000 h00S<00 C<0 $0S D00CD0\ Sh081;S l0 0 d00c?0?0l 06?O01 0 0(0 d 00cd0 ` 00`0 $0S \0  0C\0 \0  0C\0 00S \0<  0C\0 \0[   B L  !b@  b  0C\0 \0P  0C\0 h00S<00 <0 H0S  0s 0[00K [ 0 01R [ 000L 00 [R  0s 0[00K01 [R *,0S|0[0L 00 [Rt 40S,0S 01 [R:<0 [!h 4 40S3 4 6?OR 40C40S01 [R*h081;S 0[0L 00 [R l0 d0 c0 l0 6?O#4 6?OR ,0S0[0L 00 [R<0 [!0[0Cs <0!00S\0 \0 0KH-@M( , 0 40 0K 0<0 ,00 40 0 (0(0 (0 0K,0 N0KH-M  0 0(0 00,0 0000 000L0 L0SL0K .( (0S (0L 00 L0,Lh K0K 0(001S/ `000 `000`002<S `0020s0S 00@0``P00000s0s0S ` K 0S 0@l0S<(001S/ `000 `000`002<S `0020s0S 00@0``P00000s0s0S`W 0S 00K$XH-XMH H000 @0K H000 0 0 00 00 001 000S00R000 00 0S H081 0S025S 00 0S 0 00R00 0S H0 H0 00HHHP@K  0S 00$0H0 H00H 0S 0000S!00 01H r 0S 00S00 01H 0 0S 000 01H P 0S 000 0 0S00 01H 0s 0S 0}H0027S 00S 00H00 0 0S 0e0 $ 0S0]@0K  D K H 7 0S@H00 0 H00$0$0 00S H0  0 H00$ 0  00 0S 0S0 0 00S 00H000 0S 0S0 0 0S 00S 0 $ 0SH H 0KH-PM@ @00 0 0$00 @000 0 @0 @008K 0S 0;40K }@0 @0 80@H@P4K  0S0<0 40K  < K @ 1O @0 8 @00 0S 0S00 0K-M  0000S 0.000 000002<S 0020s0S "00B000000 000S0 0 00Ћ/H-M  00$0 00K KF 0S 0 01S00 6?O0 00$0  000KH-0M $ ( 00 0 $  02<S  020s0S 00@000 $000C SRT$ $ 02<S  020s0S 00@0(00000 000S"SS 000s0 ?00 000s0 ?00 0 00 0 0S 0 0 $00000 (00S6(0 $01R*(00 0 (00000R (00 $( 0(0S (00 0 (00C000R (00C $( 0r$ $ 02<S  020s0S 00@0(00000 000S S S( 0 00 6 00 $ $ 02<S  020s0S 00@0(00000  0S 0(000s0 ?00  0 $0040 0 $00*0 $( 0 0S 00KH-8M  $0 000  02<S 020s0S 00@00 0 00S5 000S0 081<S+000S 000H0S 000H0 20S0 0 $  0 0S 0T0 0  0S+ $00 001K01 0R 000  00  01 00c0  00 0![ 010s 0!010Cs 0!01 0R 00  000  01 00c0 0KH-M  00 0 0$0$0 00(0 00K00 00 0S (0(0 0 (0,0 0  001S 00C 0 (0( 0R: 00 (0,000S (0,00  0So0 00$ 0Sa0 00  0SW00 00 0 0SK0S 00S(0,0,0 (0 , 00 (0, , 0S40000 0010K0 0 00$1 0 00S 00,0000 00S 0S000 0S(0(00 +0 0 00$0 00S 0S000 0 00S 000000 00S 0S000 000   0R:0SS b0 00$] 0S Q001S 0 00  0S ?001S 900 (0 00R(0  0 00S 000000 00S 0S000 0S 000 (0,0 R5000 00S 0 0 00$c0 00S 00_000 (0, 0R*(0( (0, (0,0 (0,0  0(0( (0, (0,0 (0,0  (0040 40R0[S 000 00 00 00 00 400 0 K  0 0SV0 00KK$ 0SI01SG00S S+ I0 0 02<S  020s0S 00@000080 8000S 80 00 0S8000 0 0 02<S  020s0S 00@000000 0 K  0; 0S0 00KK$ 0S00S 000Sz 081<Su000S 000H0S 000H0 20SbT0K 0T0 00P0 p0K 0 02<S  020s0S 00@0000p0 00S p000s0 ?00l0 00 0000S 00S0 0 00S010s001TK 0p0K0 0P 0S c0 0  00 (000S 00S00S 00S0 0 00S010s0010   00 (04  (000S 00S0  004  0S0 0S 00 00  00 0S 0K0000 00S 0S000 0S 0  00$0 00S 0S000 0S 0K0000 00S 0S000 0S 0  00$e0 00S 0S000 0S2 0KH-pMP T X P000 0L0 L0H0 0,0 0<0 0 0 00 0$00 00 T00S( T00 , K P 0 0ST0P0 P00HK 0S T00 7 H00 T0 0S( T0 0 < K P 0 0ST0 P0 P00LKx 0S T0 0   L0 0 P00S8 P000S3 P081<S.P000S P000H0S P000H0 20SP0 T0T0 T0D0KX   03 0S r0D0 0@0 H0S H0D KL0S L0D KH0S( X0SH0T  H0X  P0 H P00} ,0S ,0KP}000 0S 0S00 0S1L0S( X0SL0T   L0X  P0 L P00Q <0S <0KPQ000 0S 0S00 0S0)H0S P0 H P00',0S ,0KP(L0S P0 L P00<0S <0KP0KH-$MA@ $ 000 000 00 0,00C0 N 00$ 0 00  0S 0@0 00   0S 02000Cs 0 000000  $0 0S  P7?OR  00, 000P 000C0 0( 0R0KXH-MdA@ 0 0K@ p 0S 0G 0$!0  0 ! 0!  0  !0  `!0  !0  !0  0  0 8 0  !0  D"0  !0|  H"0p  !0d  L"0X  !0L  P"0Klp@ 8\ 4!!H-M 0$10 0S0040S 040P0 0S 0 0 0w00r0 $!0K-M   00 000S 00 0 00 0 000S 00-0 00 0 00 0S 00&0 00 0 000S 00%0 00 0 Ћ/H-MA@ $ $000 00S 029S 00T10 P0K0 0S W 0S 0>00S J 0S 010 0S 026S0 0S 020S00S 00S 0h   0? $ ኿0 00 00 0KXlH-M@@  029S 0000 0 0S 00$10 0  0 ,00R0  0KYpH-M  Ͽ 0S 00$1 0 0 0 0KH-M@@  029S 0000 0㥿 0S 00$10 0S0040000  0KY0YH-M00   ")R   d 0 b0m 0S 00$1 0 0  0KPY-M   00 00@0S 00%0 00@ 0 00<S 00$0 00,0 Ћ/H-M00      -R  ")R   d 0 0 0S 00? 0KxXH-M   0S 00$1 0 0 0 0KH-M00   ")R   x 0 0ξ 0S 0 0$1 0 0  02 0"0KLdYH-M   㯾 0S 00 0S0,1 0 0 0 0$10 0 0 0KH-M00   ")R    0 n0 y 0S 00$1 0 0  0,10 0  02+0"0KxYH-M   T 0S 00 0S0,1 0 0 0 0$10 0 0 0KH-M00   ")R    0 0  0S 00$1 0 0  0,10 0  02(0"0KYH-M   0S 00$1 0 0 0 0KH-M00   ")R   x 0 0Ͻ 0S 0 0$1 0 0 0 0 {0KPYH-$MA@  $0 00 0$10 0 |10R0 h10R 00P100I0 02<S 020s0S 00@0 c000% 0s0 0Cs 002<S 020s0S 00@00c#1s0 0Cs0R 00 00H000 0喻0KlpYYH-4ME@( , 0 (000 000 0 (023S+ $0K K $0K0 K $0K0 K $0K0 K 0K$ K 0K0$ K 0K0$ K 0K0$ K 00CS 0$ , 6?O'(023S  0$ , 0002 0S 00000@$  0 0S 000000S (0 0S (0 (㺼 0S 0(0 0S (0 (㪼 0S 000000s0S (02 (0" (020S 830, 000000S (0 0S(02&(0"(02& "  0㳽 0S 0(026S 20, 000000S (0 0Sy(02+(0" (02;S  20, p0y00000S (0 0S_(02%(0" (025S 10, T0]0000 0S (02#(0" (023S X10, <0E0000@0S (00S(0!  (02,(0" (00S 00, 0&00 (0 (08 0040 q0(0 0S\00H000K,Z`ZZZZ [P[[l[ \@\H-HM8 < @ D0 0 0 00 80$10 000 80$00 00 0K 8<@  0S 0 D00K 0e 0S: 00D KK< I 0S-0 b10@R!0L 0 0T0 0 0P 0 D 0 0X 0 00S 8026S0 00 $ 0S   00< 0S 0S00 00S 0 00K000 0S 0S00 01 0S 0S00 0KH-M   0 000 0$1 0 ,y0 0   b10@ 00  0 0 020s0S 000s 0 02<S 00, 0 0 0!0  0  0  020S 000 00 02;S 000 00 026S 000 00 025S 000 00 023S 000 00 00S 000@ 00 0 0S000 00 04 080  0 0L 0 0P 00 0T KH-MX \ ` d0 X00 0 X0$00 0L0 00 0T0 X02;S 0P0 P0K  K \ `0 0S 0e0<0 080  <0KX *0 X 0 P0 < KX` 0S  X00\i 00 0S0P0 P0K L K \ `0 0SL0  L0 L0  L0 !L0X  r !L0  L X0 0S000L0 L0  L0 P0LX` 0SL X00\ 0L0 0S40K GX00H0 X0"28@0D0 X0 0@0 H0K40 000 X0 T0K ݺ 0S 0T00 0<0 080  <0KX 0 X 0 X0 40KC 0SX0TX0 X029S 00d    0 ` 0ぷ 0S`00 T0L0 L0  L0 L0  L0 !L0X  r !L0  L X0 0S000L0 L0  X0L0L 40K 0S0X0TX0 X029S 00d    0 ` 0- 0S0L0  T0S T0 ᱾#0S  X00\A 0S 0S00 L0S L X00\/ 0S 0S00 0KH-XM@ D H L0 @00 0 @0$00 00 00 080 000s0S 00K0@HL  08 0S 0 D0T0,K 0ヸ 0SD0T0  K H L0g 0S 40KD0T 40KDy0 D0T0@L2 0SsD0 0S008 Kܿ 0Se80  00S. 00S 00H0S 00H0 20S 00S 00L0@0SL0S 0 8   @L 0P 0S108  X 80 8008@L۾ 0S" 00Hf 0S00 8 00HZ 0S080  0S  00H; 0S 0S00 80S 8 00H) 0S 0S00 ,0S 0 ,0K᫶000 0S 0S00 0S 0Ӹ 0S 0S00 0KH-MO@  0 0:K:[:K00D0 D00H0 D0$0L0 00P0 D0$1T0 P000 P010K0@0 @080 8000 00,0 D02;S 00 0S 0 0 0R 0 0 0H O000 0S 0 [ D 0000 040 D02;S T0 0R*T00H ት000S T0 0R040 T000 40S00 0S 0K0[ K< <0S <0]0K0 0S,D00S( 0 00[QDK D 0/< <0S <050S H<00+0 0 P0< 0R0#03X0 00C S񏐕9740 P0<R00(0 (0S 00 0 00s00s0 ?0 00 0 X0S 00 0 o0s00s0 ?0 00 0 c0(0 0S40 0D02<S D020s0S 00@0[P0000\0 \000S \000s0 ?000 00 00 00 00 X0S 000 0s00s0 ?0 000  0R* 00c 0 0 H$:0 0~01 D02<S D020s0S 00@00 c 0R*P7?O_D020S6 00S20 S/ 01 D02<S D020s0S 00@00 c 0 cD000R 0[ K0S 0$0 000 0$0 00SCL000S> D0 D02<S D020s0S 00@00c`0 X0S 00C`h0 $000$0 (0S 000C`Y0 $000$0 L00 L00 0 c$0R*Dޱ00 00KLi< <0S <0P0,0 P00RP0,0  P0 00C SEy(0S 0 [   < <0S <0 [00s00s0?0< <0S <00 0[ 0< <0S <0q0[00K00S'0[0 0[r< <0S <0Z0 0[0 0ֹ< <0S <0K0[00KP010s P0!0[00KP010s P0!00S~ [0[>< <0S <0&0 0[ 0㣹< <0S <00[00K`0 0[D 0< <0S <000S0[00K0 0D02<S D020s0S 00@0[0000\0 00S 00 S\000@0 X0S\000S 0[ < <0S <00,0 080 H20 0X0S 0 [   < =00s0S ~0f0K00s06Kh0K0 00  [00s00s0?0K< 80S 0[ 0唺<  [00s00s0?0< <0S ,0S0 0[0 0ݸd d0S Hd\10 ᡱHd%0I<0G0S 0 0[ 0< <0S <0600S0[0Cs00[P 1P000S 0S@0S ^< <0S <000S 0[0C :[< <0S <000ST0 0 <0Kt\\\H-M   0 0S 0 000/02<S 020s0S 00@0  R  00000 000S0000 0 0KH-lMX \ ` d0 00 X00 0 0$1$0 X0d0(0 (0 0R* 0 (0 2, ,0S (0  (0 ,0(0  (0 02;S $000 峷`00 0S \0S (00 `0000 `000 d01 0R#dd 02<S  020s0S 00@0d  R  00000 00 40K0 0  0 000SOP0K dX0 X0 0@0((0P0K@ 坱, ,0S ,0`000 (00 `0000 0 `0`0 00R\0 `0`0 000c00 `0 `00R `00  `0 000  0000 <(00 `000P01 !`000 (00 `0000 `0 `0 0000 00 00R`00 0 00 00000c 00 000c 00 `0 `00 `00 00 02;S $000( 0(0 (0  (0  ` (0@0KH-Mx | 0 x00 0 | | 02<S  020s0S 00@00000$0 x00S x000S x081<Sx000S x000H0S x000H0 20S$00 00R012K01K$000 000 1[01K000 000 ![2[R*0 00R "[1[0c2K01K$0 $000C00 00 000C00 1[01K00C0 00C0 ![2[R*0 00R $0 1[0X0 $00 [1[00cT0 0 1[0t0 0 [1[00cp0 x0 |0|@|$[[@ XKtK  0, ,0S ,0|0 |0  |  02<S  020s0S 00@0000 | |0100 $00 $000s003K00s00s003K#[3[RS #[3[0c80  0R000 0  0 8 r  r 080  00c z000 003K00K0[00 00#[R :0[00 0 [ 0 8 r  r 0[00K|01 [R:|0!80s00s |0!80 00 0$0 $0  00s $0 $00 00 a0K-,M $ ( ,0 00 0 (  02<S  020s0S 00@000 ,00C,0 ,0S ,00 0 ,00C000R ( ( 02<S  020s0S 00@0,00000 000S000s0 ?000 00,01K$0S000K,01K0( ( 02<S  020s0S "00B0,00000 000S000s0 ?000 000[00K,00,0 (01 ,0R 1[0 0 ,0000R 0[S0 00#!0R00 [ 0Ћ/H-XMH L P T0 H000 0$00 L 02<S 020s0S 00@000 P00CP0 P0S P00 0 P00C000R 00S0 0D KH; 0S 0D0D   D0 D0  D0 !D0  r !D0  D0D   @0K &P01KP00K00K![L00D[H P0 0SL L02<S 020s0S "00B0[0000 0 0@0 000S 000s0 ?0 0<0 00S+ 00s0s0S% 000S2L L02<S 020s0S "00B0[00000H| 0S ZD [<0@KH 0SH0[00KT0S [1[0HLp 0S 80[00K [<0HLc 0S)P00P0 T00CT0 T0S]D00![  H L0+ 0SL01[0 [P00c0H害 H0 D H00$ $0S 0S$0 0 0KH-HM8 < @ D0 <0s00s00K<0S0K08 g 0S 000 0 @00 0 0 00K 0K00 0,0 00K0008D 0k0K0H- xMp t x |0 00,0 0`0 `0\0 \0X0 X0T0 T0P0 P0L0 0d0 0@0 0H0 0D0 00 0S 000t D K@Kp 05( (0S ( N7?ORH0(0 ,D0$00 @0D d0Kp ޲( (0S&d@0@ @0D0 ϫd00h0 @0<0l0 l0S0000 @00 P K , 0( (0S ( 6?OR D @00( 儬( @0 0 ` K , 0۫( (0S ( 6?OR D @0 0( g( |0S |0S00 0 0 00 00Sy l0K X K , 0㰫( (0S ( 6?ORf D l0( =( X0 @0@00R X0 @0@00R*00X0 @0@00R X0 @0@00R*00040 |0S |0S-40S*X00SX00S X00SX00Sp00S p00H0S p00H0 20s0S X0 @0@0p ᦲ( e40S000 P0SZ P0 @00R P0 @00R*00P0 @00R P0 @00R*00040 |0S |0S-40S*P00SP00S P00SP00Sp00S p00H0S p00H0 20s0S P0 @00p H( 40S00 `0SZ `0 @0$0R `0 @0$0R*00`0 @0(0R `0 @0(0R*00040 |0S |0S-40S*`00S`00S `00S`00Sp00S p00H0S p00H0 20s0S `0 @0$0p ( 40S0 0 0S0S 0S D0 L0Kp 7( (0SD0 \0Kp ,( (0S00SJ L0@   L0 L d00S d00S @0 000L0 !L0D  r !L0d   L0d   \0@   \ d00S d00S @000 0\0  \0 !\0D  r !\0d   \0d   _L0d   L d00S d00S d0 00 0L d00S d00S @0 000L0 !L0D  r !L0d   L0d   \0@   \ d00S d00S d000 0\ d00S d00S d0000\0 !\0D  r !\0d   \0d   Dd L0@, 0X( (0SDd\ @0,0dK( (0S0S/ D0 P0K   , 0㚮( (0S D P00( ( PL D00 9P0x P D00,( (0S{0P0 0S/ D0 `0K   , 0g( (0S D `00( ( m`\ D00 `0x ` D00,岳( (0SJ0`0 00Sr 0So d00S d00S d00 S00 @0\00$0 00 0$0 D0 X0K   , 0( (0S D X00( 垩( X0l  X0 X0  X0 !X0D  r !X0L   r  X0 r  X@$0S D L0፬PD \0ᇬ000 0X0x X D00,>( (0S0X0 00S@000S @000 T K , 0㭨( (0S ( 6?OR D @000( 9( T0 @040R T0 @040R*00T0 @080R T0 @080R*00040 |0S |0S-40S*T00ST00S T00ST00Sp00S p00H0S p00H0 20s0S T0 @040p ᦯( e40SHD0 T0K   , 0D( (0S D T00( Ȩ( JT0@  T0x T D00,哲( (0S/0T0 h0K X K , 0 ( (0S 0X0 8x0 X00R2x0 X00R,D0 X0K   , 0( (0S D X00( ~( X@0@ @0D0 ᘧX D00,H( (0S0X0 00S P0S`0Sr 00S7 P0S4 x0 P00R.x0 P00R(D0 P0K   , 0㲬( (0S D P00( 6( P0@  P D00,( (0S0P0 `0S4 x0 `00R.x0 `00R(D0 `0K   , 0z( (0S D `00( ( `0@ $ ` D00,̱( (0Sn0`0 00SS@000SO @000 T K , 0=( (0S 0T0 =x0 T00R7x0 T00R1D0 T0K   , 0,( (0S D T00( 尧( 2T0@  T0@ 4 T D00,z0S0T0 @ x0 0(0  X0S X D00,M8 80S (0S80(0 P0S P D00,;8 80S (0S80(0 T0S T D00,)8 80S (0S80(0 `0S ` D00,8 80S (0S80(0 L0S L0pm\0S \0pfd0S d0p_@0S @0pXH0S H0ẩ< <0S (0S<0(0 (0 K0H-XMH L P T0 000 0<0 0(0 000 0,0 00 0S 000L , K(KH 0S 0S N7?ORl0 0 \, 00K ߤ 0S]000 8!,8!,0$00 (0400 0@0 @0K < K  0 0S 6?OR: , @0 塦 5P0 <00R P0 <00R*00P0 <00R P0 <00R*0000 <0 (0X0R <0 (0X0R*00<0 (0\0R <0 (0\0R*0000 T0S T0S-0S*<00S<00S <00S<00SH00S H00H0S H00H0 20s0S <0 (0X0H 0SLT0S T0SF00 <0K    0ㄪ 0S , <00  <00S <00S<0 0 <00S<010s0<01 0 <(0 (00 <00S<0  <0  <0P _0S\T0S T0SV00 <0K    04 0S , <00 帥 L<0  <0( 8 <0  <0 !<0,  r !<0<   r  < <00S <00S <00 S0000< (0@0(< 0S <0( X < 000L 0S(00 < K  0Ĥ 0S 6?OR , (00 P (008 K P0 <00R P0 <00R*00P0 <00R P0 <00R*0000 <0 80R <0 80R*00<0 40R <0 40R*0000 T0S T0S,0S)<00S<00S <00S<00SH00S H00H0S H00H0 20s0S <0 80KH ᙫ j0S"T0S T0S00 <0K    01 0S , <00 嵤 I<0P )0S&T0S T0S 00 <0K    0 0S , <00 古 #<(0 (00 ᩣ< 000Y 0S0<0 ( P0 0 0 <0S < 000;(0S (0Hᚫ00S 00$ $0S 0S$0 0 0KH-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0R 0S N7?OR10 0 !$ (0K ! 0S"(0( 8!,8!$0$00 00 , K  0Z 0S 6?OR $  00  80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 00R ,0 00R*00,0 00R ,0 00R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 000 1 0S0<0S <0S*(0 ,0K    0ɧ 0S $ ,00 M d(, 0 0$0 (( 0SQ,08 60S3<0S <0S-(0 ,0K    0㕧 0S $ ,00  0(, 0 0$0 (\ 0S,0  , (00֬ 0S0,0 80 0 0 ,0S , (00帬 0S 00(0S (0y 0S 0S0 0 0KH-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0ᣦ 0S N7?OR70 0 +$0$00 00 , K  0 0S 6?OR $  00 t 80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 00R ,0 00R*00,0 00R ,0 00R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 000 Ῠ 0S<0S <0S$0 ,0K    0W 0S $ ,00 ۡ {,00S ,00S ,00 SH,0 ,0$02<S $020s0S 00@0  000 ,0,0$02<S $020s0S 00@0  0000 0$000 0(00s0SO ,0,   $  G,0 ,0$02<S $020s0S 00@0  000 ,0,0$02<S $020s0S 00@0  0000 0$000 0(00s0S ,0,   $  ,08 0S<0S <0S$0 ,0K    0㔥 0S $ ,00  ,00S ,00S ,00 SH,0 ,0$02<S $020s0S 00@0  000 ,0,0$02<S $020s0S 00@0  0000 0$00c0 0(00s0SO ,0,   $  b G,0 ,0$02<S $020s0S 00@0  000 ,0,0$02<S $020s0S 00@0  0000 0$00c0 0(00s0S ,0,   $  b ,0  , $00I 0S 0,0 80 0 0 ,0S , $00/ 0S 00Ꭷ(0S (0 0S 0S0 0 0KH-HM8 < @ D0 000 000 0$0 0,0 0(0 00 0S 000< ( K$K8 0# 0S N7?OR0 0 (0$00 $00 0 K  0_ 0S 6?ORp ( $00  s@0 000R @0 000R*00@0 000R @0 000R*0000 00 $00R 00 $00R*0000 $00R 00 $00R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $008 6 0SfD0S D0S`(0 00K    0Σ 0S ( 000 R $0 000S0000 00 00(02<S (020s0S 00@0000 0000(02<S (020s0S 00@0 00000<(0`0 0 0 (0D (0H0  1(0H0 0 0 0 00(0d00c (0d0  0P(0 L0K L0X. 0SP0` 0Sd0S d0S00 P0K    0B 0S , P00 Ɯ L0K ΢(0` (0d0 (0,00H0 H L0KX ע 0SL0 0 0 (0`0  Ǜ(0`0 0 0 (0( (0,0  ẛ(0,0 0 0 0 00(0d00c (0d0  ᦛ0P(0 L0Kj L0Xᷣ 0S_(0$0S: P0 P0,02<S ,020s0S 00@0( 000 P0P0,02<S ,020s0S 00@0( 00000<,0S ,0᠋ 0S 0S 00 0KH- @000S9 @081<S4@000S @000H0S @000H0 20S!@00S @000S @0 00000K  0 0S 00L0 S L0S L0S00@D 0㦆 0S 6?OR 00 @H L0 0000S 000s0S 00 L00 004 K @"0㤅 0S0,0 0 0,00 0 0,0 0!00S 00@]00 0 0S 0S 0 0 0,0 00,0 0$ 0S00@DH 0^ @g$ $0S 0S P7?OR$0 0  P7?OR 00(0 @( ً 0S e 0SYL0SY S S80K@ v 0SK0S00 0 80S@00S @000S @081<S@000S @000H0S @000H0 20S@00S @000S @0 00000K  0 0S 80K@ 0S00 C0 80S@00S @000S @081<S@000S @000H0S @000H0 20S@00S @000S @0 00000K  0㚆 0Sx 000S 000S| 80K@ Ë 0S80Sc@00Sa @000S^ @081<S[@000S @000H0S @000H0 20SJ@00SH @000SE @0 00000K  0B 0SZ.,*(&$"  @081 0S&L0S L0S D0S 00@ $ @ $   D 0ń 000S 00 0 0 0KH-8M0 4 8 0000 00 0 000$0 $00(0 0H0S 0H0 Έ0S 7?OW40S00 00000 0000S 0000L 0L0R 00 c0(0S 0(0 ᢈ0S 7?O+00 0 ; 00,0 $0 ,00R/,0 (0R*,000S% ,000s0S ,0 0R: 00S 000:S 00 0S ,00 ؈0S,0000 00 0 0S0(0S 0(0 0S 7?O000 0S 0L 0L0R 00 00 00000 0000S 0000L 0L0R 00 0(0S 0(0 0S 7?O00 0 g 00,0 $0 ,00RH 00S 000:S 00 0S ,00 c0S3000 00 40S;>,0 (0R,00 C,0 ,0 (0R,000S ,000s0S ,0 0 ,0 ,0 (0R,000S ,000S,000S ,00 ,0 ,0  $0 ,00R$000S $000s0S 00s00#s ,000S ,000s0S 00s00"s0Sa $000S $000S $0 ,00RS,00 ,0 00 L$0 ,00RF$000S $000s0S 00s00#s ,000S ,000s0S 00s00"s0S" $000S $000S $0 ,00R,000Ss ,00 ,0 ,0 o0SC$0 ,00R6:$0 ,00R7$000S $000s0S ,000S ,000s0S $0 ,00R:$000S $000s0S ,000S ,000S,00 ,0 00 ,0 (0R0S ,0 $000c ,0   00 0 0S0(0S 0 0(0+~0S 7?O!000 0S 0L 0L0Rd 0H0S 0H0 ~0S 7?O80S 80  0KH-M    0 000 00S 00000 000 0 0S00h00݈00S 0  00S  00K\]H-0M $ ( 000 0$1 0 (0S 080S 0S0K ނ 0S 0I 080S0$ R $ 0S  6?OR 030K ᾂ 0S 0)(0S 0 $0R:0 0d00 0  0  0K  0 0S 0000  $0R:0KH-$MA@ 000 0$10 0 0  K  0 0S 0%0 0ᴅ 0 0 0 t00U 04 040S Y| 0 00  }00 8 0Kd] ]H-|M`E@x x0$10 x000 00 0p0 000S0C0 0S0 0 0:D0K 70@0 h0KD0 `0K .H0@0H0 0S 00S 0000S 0010Sj~0080S0d0 d0K 0S 0d (0Kx { 0S 0(0  0S  6?OR040S 040ހ0S { 0 0X# |0 4 0 0 430~ 0S { 0 0" |00s0i0K0h0 d D0K`Kx "  6?OR? R 6?OR b\0S8 ` \0 0h| \0R/ Ax02;S+ p0S0 p0K ᕃ 0S?p0 00 pp 00 0?| 00R 00 &x02;Si0K 0$|0S 3{ 0 0! Z|h00h0 0S 30S {$ 0 0$  @|0S$00 (0$ $0S 0S$00 `0S `0ᬅp0S p0:0S0 0 0K@ ]$](]H-PMH L H00$10 H000 0000 @0KH΀ 0S 002;S 00<0 H0H00 0 0R*0 0 ) 0S 0  0 00  <0K 㴂00<0 080 02;S 000 040@ 0s80SNq<0 80 q080 00C0 0SB040# 0s80S3T0 0R/ <0 80 q080 8 00R000 0 0 0 ἄ 0S 0  0 0600<0 0< @0R:@00@0 @ K<0KH 0 0S0<0 0< @ L0Rt:0 8 6?O 0 0S0 0 0KH-0M $ ( ,0 000 ,0SB22 K $ 0} 0S 00 0 0,0 0 0,00 0 0,0 0!00S 00 }000 0S 0S00 0,0 00,0 0$ 0So0S4 ,0S1000S 000S'00 00 002<S  0020s0S 00@000000s0s0S6?O0 :,0S 000S 000 $  (3/ 0S#0S 00 ( ]{  P7?OR R _0 0 $  0SF  0S K 0S 0S00 0KH-pM` d h l0 `00$0 $0$0(0 `00,0 0P0 ,0( ,0, ,0,0 ,0,0  ,00X K `l h0堄 0S 0,0,000 ,0,0LK0,0,00P0 ,0( ,0, ,0,0 ,0,0  P00S P00SP0 0 P00SP010s0P010 h0@0S 0 000 d0  9d000  0R0 .0 h0:S 0 0R"*`0 P `00(| L0S L0K`||0000 00S 0S00 0 0S 06?Oi00 P000C SUPONML 00c0 P00S00K00K00K00K00 00KP01 [R/:0 h0:S 0 0R#*`0 P `00( 0P0 L0S L0K`|0000 00S 0S00 0 0S6?O 0 P0 P0$02<S $020s0S 00@0[[00000s0s0S 000  0R,0, ,000R [0[00K$00,}00 0 0S,0,0P  ,0,0 [ ,0,0P ! ,0,0L0K,0,0  0S000KP013KP0 P0$02<S $020s0S 00@0[000080 0[00K [3[R 80 0 0R*800 00 800T0 v 00c0 00C0 ,0, ,000R$00,}00 0 0S,0,0P  ,0,0 r ,0,0P ! ,0,0L0K,0,0  0S0A00KP013KP0 P0$02<S $020s0S 00@0[0000<0 0[00K [3[R <0 0 0R*<00 00 <00T0 $0 P00x00[0C0KP00 l0R-,0, ,000R$00,|00 0 0S,0,0P  ,0,0 [ ,0,0P ! ,0,0L0K,0,0  0S0X0SC ,0, ,000R$00,s|00 0 0S,0,0P  ,0,0 [ ,0,0P ! ,0,0L0K,0,0  ,0,0 ,0, 0Sn0P0 00 T0 L K ` 0z 0SD `h0;S l0s00s P000Cs0R*P00S0X0 `0 P `00(^ 0S>0P0 X0S h00S 000 T0 L K ` 0y 0S L0S" `0 L0Kx`0 `00TKPK(w 0S P0S `0 P `00(0 00S 0S00 0 ,0, ,0(0R ,0,0 C,0, `/} 0KH-DM0 4 0000 0$00 0000 00 0 0(00 00(0 (00S (00S00 0000(K]|$ $0S $0( 0 000S= 0000S8 0081<S30000S 0000H0S 0000H0 20S 00 (0(((@ T4  0b$ $0S $0(0 (0  (00S:(0 (002<S 020s0S 00@0000 (0(002<S 020s0S 00@0 000040009(0 (002<S 020s0S 00@0000 (0(002<S 020s0S 00@0 00004000(0 0R(0(  4  000 0, 0R *0KH-8M0 4 000 0 0$00 0000,0 ,0 $ K 0 0cx 0S 0D00 000,K(KEv 0S 03(00S (00S(0 0 (00S(010s0(014 000 ( 000嗀 $0S $0K0x000 0S 0S00 0K-M  00 010K000C S񏐱^*00K" 02<S 020s0S "00B0[00000s0s0S000 0[00K [0[R:|00K" 02<S 020s0S 00@0[00000s0s0S000 0[00K [0[R:Q00K 02<S 020s0S 00@0[00000 00 0[00K [0[R:*010 &00K 02<S 020s0S 00@0[00000 00 0[00K [0[R:0Ћ/H-HM8 < @ D0 8000 0$00 8000 D0:S 800S 000S 00 000 00S D07SD08S D00S 00 <0 , K 8 0 w 0S 080 800<K0Kt 0S ,0S 80 ,0Ku 000SD0;S @0s00s 000R*D00S 000S D07S 000 @0R8081 0S80000s0S8000S 80 0 800 ,0S 80 ,0Ku000 0S 0S0 0 0S 000 <0 , K 8 0v 0S 080 800<K0Kmt 0S ,0S 80 ,0Kku 0lD0;S @0s00s 000R3*D00S 000S+ D07S 000 @0R! 80 0 800~ ,0S 80 ,0K:u000 0S 0S0 0 0S 0,0 0, 000R00Hx00 0 0S0,00  0,0 0,00 ! 0,0,0K0,0  0KH-MO@p t x |0 p00(0 (00,0 (0$000 p0040 0`0 (0$180 00 0$0 40( 40, 40,0 40,0  t0S400t0 l0K0pt |0} 0S 0[40,000 40,0\K040,00`0 40( 40, 40,0 40,0  p081 0S (00S (00>080 0<0 `0 (02<S (020s0S 00@00@0 `00S00D0 |09S* |08S`01S01K `00S`010C1K`010C1K`00S |07Sk`00 0Rg|08S 00K`0!D0s0 01KB1[0s0D r s 0[01Kp0 p00`[<hK ( x0vz 0Sgh0S`00S |07S.`00 0R*|08S }h0SD0s 1[00K1[0C1K1[01K1[S`00S |07S`00 0R 0 |0;S 6?O 0 B|09SK 40, 4000R,4v00 0 0S40,0 40,0 [ 40,0` ! 40,0  40,0  \0S p0 \0Ks00H0 H0S 0SH0 0 p0 ` p000|H H0S 0SH0 0 0'|08S\ `0 t0R6?O 0 \0S p0 \0Krs00 0 0Sp0 ` p000| 0S0`0 |08|0 |08|0 40(0001K40(001![R6?O 0 40,0 40, 40(00`0 40(0 40(0\K040(0  pw 0S0l0 K|07S 40, 40(0R40,0 40, 40, 4000R,4t08l0 0 0S40,0`  40,0![ 40,0` ! 40,0\0K40,0  40,0 40, 0SH0\0 I40,00S |08S ![`010CR40,0 40, pru 0S+40, 4000R,4s00 0 0S40,0`  40,0![ 40,0` ! 40,0\0K40,0  0S0\0 0`0 $0S |00S 00 d0 \ K p 0q 0S \0S p0 \0Kzp|08S l0S40,0 40, $0l0 p0 p00dK`K0Uo 0S  0 `00S8`01S4|0<S 1[01K`010Cs0![R%*1[0@ 0 1[00@00R |0<S 1[0C1K1[S 1[0@ 0 1[0C0@00R |00S `00S00L0 |0<S> D0s0![0c1K`0 `0(02<S (020s0S 00@0[L00000s0s0SP1[SM 1[0@ 0 [D00c0@00R >D0s 1[01K`0 `0(02<S (020s0S 00@0[L00000s0s0S`0!D0s00cs0![R *1[0@ 0 [D000@00R `0 `0(02<S (020s0S 00@0[L00000s0s0S6?O 0 0S/ 01K$`0 `0(02<S (020s0S "00B0[00000s0s0S000 1[01K![1[R:0 0 |09SJ 40, 4000R,4Zr00 0 0S40,0 40,0![ 40,0` ! 40,0  40,0  \0S p0 \0Ko00H0 H0S 0SH0 0 p0 ` p000axH H0S; 0S8H0 0 5|07S 40, 40(0R40,0 40, 40, 4000R,4r00 0 0S40,0`  40,0![ 40,0` ! 40,0\0K40,0  0S0O `0S p0 ` p000wH H0S 0SH0 0 \0S \0Kpo00H0 H0S 0SH0 0 40, 40(0R 40,0 C40, ps 0KH- M $ 000 0$00 000 0 0 0(00 b00S$ $00s0S 0 00R0  0  0 0 00w 0S 0S0 0 0 $00S1$00S 00S 0 00 n000 0S 0S0 0 00S 00 ko000 0S 0S0 0 000 0, 0R*$00S 0( 0, 0,0 0,0  0KH-M  000 0(00cC!=6K0 0 0K p 0S 0*0( 010b1 \l0( 040R 0(0mt 0(  010b1 0,  010b1 00 0KH-8M $ ( 000 000 00 0 0 00S $0    K  :n0$0 K * 0n00 0S(0S 0,00 0R 0,00C000( 00<0s0 ?000S ! 30,00 002<S  0020s0S 00@0,p0s00cs0R qM0,00 0R0,0 L0 0,0 C0,0  00 0( 0, 0,0 0,0   P7?OR R  0S0$0S00 0S00 0S 00 0 T 00C 0 P(0S 0 (0 0K0H- xM\60X \ X    $  L L H \   R  \   0u00 (\X0 X00Xp 0S\000 H0KX u 0S \000 L0KX t 0SH0H   H0 H \000S \000S L0000H0 !H0  r !H0\    H0\    L0L   L \000S \000S H000 0L0  L0 !L0  r !L0\    L0\    H L0NKX\  0SX00S] X000SX X081<SSX000S X000H0S X000H0 20S@<0K q\00<0 0080 0D0 0@0 X0000S000 X0 \00HPH@LLHXP@ DK<K $ 0s 0S ?\00 \00  H0\  L0\  X00S\0H L0Xx0 \04[ H0LX00 0S\00H0 L00[Xs X0 \0 X00t 0S 0S 00 \00S \00Xl00 0 0S 0S 00 H0S X0 H X00t 0S 0S 00 L0S X0 L X00t 0S 0S 00 0 K0(L]pH-M  000 0$0 0 00 0$0 $00 00 0\0 0l0 00 000 0K p 0S0    000S 000S 00 00 00  0 !0  r !0    0    000$0 $0  000S 000S 0000$  0000S 000S 0000$ 0$0 !00s $0!00 $0 00 $0 0 K  $0L 0SE8[ 0$t 0S9000S 000S 000 S%000S 000 l K  0Pk 0S000 00K 2i 0S000 0K r 0S00 \ K  0#k 0S0    $0 0 00  n 0S0 00 m 0S8[ 0$s 0S00(0 00Sj 000Se 081<S`000S 000H0S 000H0 20SML0K _o00L0 00H0 0S0t0 0p0 (000S00,0 00000`00P0@0010S 0 0St0K0`P@  000L0K 0,0$0 0p 0S N00 00  0  0  0 $00S 0   |0K 02<S 020s0S 00@0$0$ g $01$01$  0$010c g0| K0 |0K0 02<S 020s0S 00@00 g0 01 01 0010c g00| K0S 0$  0000 $00[p 0S0 0o0  00 4r0 00S 0S000 \0S \0K,j0000 00S 0S000 0 0 00 r0 00S 0S000 00S 00j0000 00S 0S000 0 0 00 q0 00S 0S000 00S 00i0000 00S 0S000 0S" 0  00 q0 00S 0S000 l0S l0Ki0000 00S 0S000 0 0S 0 0n0S 0  00 q0S 0  00 vq\0S 0 \0Khl0S 0 l0Kg0 0 00 \q P7?OR 00S 0 00g00S 00Ji0 0 00 :q P7?OR 00S 0 00g00S 00(i0KpH-M  0 000 000 00 00 00K :m00Sn Sl S 02<S 020s0S 00@000000 000S S) 003K0.0K00,0 00Kh0 0d0 000 0K m 0S 0=0 00 f000 0 00 L0K l0J0K00D0 00H0 03K0.0K00,0 00Kh0 0d0 L0K0 00 02<S 020s0S 00@000000 000S S) v003K0.0K00,0 00Kh0 0d0 000 0K l 0S 00 00 e000 L00 L0K vl0J0K00D0 h0K ll0 0 00h0KhKhK f 0Sh KL0K0 l h0S 0 h0wm 0S 0 03K0.0K00,0 00Kh0 0d0 L0K0 00 0 00e0n00 0 0  0 0  0 !00s 0!000s 0 0  @0K l0>0K00<0 000S h080 8 0 h0(0 0 (0 0 @0K0 00 0K000 04f 0S0s00s0 ?0h K K  !f 0S 0S0 0l 0KH-HM8 < @ D0 8000 8000 0 <0  <0 <0  <0 !00s <0!@000s <0 <0  40K,0 0(0 @0040 @h000 ,0K0008< 0e 0S 0 0 <0 D0040 Dnh000 ,0K0008< 0e 0S 0<0 00 <0 0KH-AMM@  0 00 0 00$0 0$1(0 00,0 0000 $000S 00S /h0040 0003K00000C Sw53rqpon000 000 02<S  020s0S 00@00000<0 <000s0 ?000 ,01 02<S  020s0S 00@0,0 c0R*P7?O00s0S 0<000S S/ \0K j<005K0Z0K00X0 40T0 \0K0 00 <0 00 <000 #[<000s0?0KK,d 0S 01<0 0@0 h0K j0f0K@00`0 @00d0 05K0Z0K00X0 40T0 \0K0 00 h0K0 00 3[ K K , 0d 0S 0000 000 02<S  020s0S 00@00000D0 D000S S D000s0 ?000 D000 081 0S 0 090R$900 00 (000 0SM  02<S  020s0S 00@0 !  R  b 0000H0 H000S'H000 H000 D000 D000 K K0 3/ 0s00s0 ?00L0 L 0R*L00 D000 ,01 02<S  020s0S 00@0,0 c0R*P7?O00s0S 0\0K i0s05K0Z0K00X0 40T0 \0K0 00 D000 00 #[0s00s0?0KK,c 0S 000 ,01 02<S  020s0S 00@0,0 c0R*P7?Ot00s0S 0mD0@0 h0K @i0f0K@00`0 0K 6i0 0 @0@00KKK oc 0S Kh0K0 Oi 0S 0 0Aj0S 00\0K i 05K0Z0K00X0 40T0 \0K0 00 h0K0 00 3[ K K , 0Dc 0S 0 J 00 ,01 02<S  020s0S 00@0,0 c0R*P7?O00s0S 00K0 00 000 400 3[ K  , 0c 0S 0 0 0000 b0$000S 00S00S8 000S3 081<S.000S 000H0S 000H0 20S0 ,0,,4a   0k 0S 0w,0 ,0  00S6, , 02<S  020s0S 00@0000 ,, 02<S  020s0S 00@0 0000400c05, , 02<S  020s0S 00@0000 ,, 02<S  020s0S 00@0 0000400c00KlpH-HM8 < @ D0 8000 <00 0 02<S 020s0S 00@00$0 00S00(0 00K 00S<00 01(00cR 0!(0s00c0K 0 0S<00S(00K0[S 0!(0s00c2K0 010c02K00K00K 000C SG  02<S 020s0S 00@0[000000S   02<S 020s0S 00@0[000000s00s 0[00K0[00K  02<S 020s0S 00@0[000000S   02<S 020s0S 00@0[000000s00s 0[00K0[ 00K0[00K  02<S 020s0S 00@0[000000S   02<S 020s0S 00@0[000000s00s 0[00K0[ 00K 0[00K0 00`00[00K [2[R* [2[R:0[0K 00S$ S" SA00  02<S 020s0S 00@0[000000S000 $00  02<S 020s0S 00@0[000000S000 00 00 0S 00 0s0( r s 0[00K 01 [R=*0S  02<S 020s0S 00@0[000000S  02<S 020s0S 00@0[000000S0[0K]0s0( r s0 [RM0s0( r s0 [0c0K0S  02<S 020s0S 00@0[000000S00s0  02<S 020s0S 00@0[000000S00s0S 0[0K000 0SU 00SU0[0$ 0 [(00c0$00RG00 0s0( r s 0[00K 01 [R*0[0$ 0 0[0$00R 0[0K(0s0( r s0 [R0s0( r s0 [0c0K0[0$ 0 0[0$00R (0s 0[00K000 0[0 @ 0&a0 00S 000[ !  D a0 00S 000 [ 0KH-0M( , 0 40 0 (02<S (020s0S 00@00 0 , (02<S (020s0S 00@000 00Kn,000C S񏐯Lke0[S40S 00K, ,(02<S (020s0S 00@04000000S, ,(02<S (020s0S 00@04000000s000Kk00Kh0[S 400S400 0 400C000R 0[0 0 [ B  , ,(02<S (020s0S 00@04000000S, ,(02<S (020s0S 00@04000000s000K 00K 00K(0 ,00]00[0 00  [ br0 0 ! 0[S]40SZ ,00SV02K00K, ,(02<S (020s0S 00@04000000 , ,(02<S (020s0S 00@04000000 0 (02<S (020s0S 00@0[0000 0[ K \40 (02<S (020s0S 00@0[0000 , (02<S (020s0S 00@04000,  0[ \40040 0010s 00!0[00K4 0R:0KH-lMI@` d h `000 000 000 0$1 0 040 0T0 0D0 0$0$0 0X0 00 00 `00(0 40KT d 0S40T 0c0\0 \0 T K ` 0^ 0S`0 `00\K0K$j\ 0S}h0S 40 @ 000\0 "40@  @ `0 `00\KXK$M\ 0SbX00\0 `0 X `00$f 0SV0X0 \0S(00\0 \0 D K ` 06^ 0SB`0 `00\KXK$\ 0S540X  ( `0 X `00$f 0X0 D0S `0 D0K ]00,0 ,0S 0S,00 0S(004  ` 50Z 0S027S 0$00T0S `00S 000 00S0SI `0 0 `00$6f 000 T0S `0 T0K\00,0 ,0S 0S,00 0S 0 0S 00TK`] 0S `0 `00S 00000K0$ 0[ 0Sh0SS0 0S 0 0S<026S7 (00 D K ` 0n] 0S(0`0 `00XK$Q[ 0Sz4 X00S X00SX0 0 X00SX010s0X01 0400 ( 4 0 0S40 000,00400 0  400 L  400 P 400 T $ 0$ \0KAb 0S:40\   400   400  400   0S 004  ( 004  , d04   D0S `0 D0K[00,0 ,0S 0S,00 X0S `0 X `00$'e, ,0S 0S,00 T0S `0 T0K[00,0 ,0S 0S,00 00S `0 0 `00$d, ,0S 0S,00 0S 40S 40cd0 0K`bK-(MG@8 < 800$0 $00(0 <000 K8 a, ,0S ,0<00S \700(P'  wd(<70rd000($'  jd000('  bd40K$a40$S S 60 0 60 0 60 0 (60 Dd000 &  ( l604^$0 0S000(H&  'b$0 0S00 0(&  b00$0(&  d000(%  b$0 0S800<(%  a00(0(%  a$0 0Sx50p500  (a000(L%  a00,0(0%  a00DP00,0S0 00D0ᜩ 0 1Y8ԩ 0`p00,0ጩ000ᆩ 0  0W 0Yʨ 000@$ (4$  _0000($  a00HP0000S0 00H0S 0 1Y8⋩ 0`p0000C000= 0 x 0 0Y⁨ 0Ϫ00# (#  _0040("  Fa00LP0040S0 00L0  0 1Y8B 0`p0040000 0 / 0ũ 0Y8 0ᆪ00! (!  a_0080(!  `00PP0080S0 00P0 0 1Y8 0`p0080ᱨ000᫨ 0  0| 0Y 0=00  (   _00<0(   `00@0(   `00(a0K0Ydh]l]]]]]]^^^0^L^h^^^^^_(_t_H_x____ `,`X`p`H-(M $ ( ,0 00 0 (00 ,0 $011K$  02<S  020s0S 00@000 $000C S񏐵)30,0 0, 0D $01 02<S  020s0S 00@0$00c 0D 1[S0<0 0< 00KB$ $ 02<S  020s0S "00B0[000000K0[s0S 0[ 1[R 0[0 0 0[0000R 0 0 0 0[0S 00 0 0[00K [1[R:000 00 0H $01 02<S  020s0S 00@0$00c 0H 1[S0<0 0< 0 0Sf 025S 0 1[ 0 0 1[ 0 100K*$ $ 02<S  020s0S 00@0[000000K0[s0S 00 0 0 0 0 0[00K [1[R:000 00 0H $01 02<S  020s0S 00@0$00c 0H 0 1[ 0 040 04 0L $01 02<S  020s0S 00@0$00c 0L 1[S0<0 0< 00K$$ $ 02<S  020s0S 00@0[00000s0s0S00 0 0[00K [1[R:040 04 0L $01 02<S  020s0S 00@0$00c 0L )080 08 0P 0 02<S  020s0S 00@0c$010c 0P  0 $00V00KH-M@@ 000 000 0<   00`00S 00|   t00v`00T   P00l`00 8    $00\ZK I`````H-@M8 < @ D0 0(0 000040K08< 9X, ,0S ,080000 @ 0!@0!@ 56"K00,00 , r 00,00 , r 00(00 00S#@0A000C 0"K 0`p00ӥ 0ᠦ 0 0@!Y0 00R @0 "K 0@ H@0@00᭥ 0"Kޥ 0`p00៥ 0l 0 0@ @0A00 000c0Cᆥ 0"Kᷥ 0`p00x 0E 0Ấ 0@!00f 02 0Kᓥ 0"K000 00, 0Rd*40S @"K @0  56Ǧ0S @0!"Kᅤ 0@!@ 0 00( 00, 00,0 00,0  0KH-XMH L P T0 H000 0$00 0@0 P0 8 K H L0W 0S 0H0 H00PK<KT 0S 80S 80KHfW 0<000C S񏐸Ld^00K;<0 <002<S 020s0S 00@0[00000 000S 0 00HT 0)] 0S00 HL T0\S 0S0[00K<01 [R:r00K*<0 <002<S 020s0S 00@0[00000 00 HL T0(S 0ST0[00K<01 [R:><0 02<S 020s0S 00@00 0 00K<0 <002<S 020s0S 00@0[0000$0 $000S60[ <01R 0[0 0 0[00 00R# <0 <002<S 020s0S 00@0[00000HT 0q\ 0S<0 <002<S 020s0S "00B0[0000$0 $000S%<0 <002<S 020s0S "00B0[00000 HL T0kR 0S$000S#<0 <002<S 020s0S "00B0[00000HT 0\ 0St0[00K<01 [R1:X00KF<0 <002<S 020s0S 00@0[0000$0 $000S#<0 <002<S 020s0S 00@0[00000HT 0[ 0S&0[00K<01 [R:0 <00:S0<< @0KTH R$ $0S 20S2 2 d0 4xP$ $0Sp0S(80 d00K P?K0 ?KfP00 00S d0K | K "0$ $0S00 0 0t0 2 d 20<X$ $0S@0,00S 2 @0,00dO00$0 $0S@0( @0, @0,0 @0,0  0d0 D0S;8700 00 0S00 00  0x$ $0Sc@0,00d0 d01S d00p0 d00p0 d0 @00R0t0  V$ $0SE0 0 0 00S 8601 01 P0SP0K W$ $0S,P000 0  P0 0-$ $0S0(000H0 00  H0$ $0S@0,00d0 0 d01S 20S @0,00 0,000R d00p0 1,0S d0 0 0R |00|0 d0K m$ $0S40$0,02 20R$ $0Sd40 0,000K O?K$1 ?KUO0 1 00S P 0,0|K"0$ $0S`0,00 00R 40$@0,02 20\R$ $0SG@0,00d0 d00p0 H30 d00K O?K@1 ?KO0<1 00S @0,0 | K "0z$ $0S d01 402<S 4020s0S 00@0d0 c2R@0,00C0 @0,00C010CRx0x0 @0(00 .00 @00R# 10 000K ,O?K\1 ?KN0X1 P 000xK 0 $ $0Sx0S 000 @0, 0Rx0S |00|0 @0,00Se d00p0 -00 @0,000K N?Kx1 ?KyN0t1 0,000p0 P0 t K "2B$ $0S|00|0 @0,00S6 @0 d01 @0 d0 p0R d00p0 /daXa001 01  0$ $0S@0,00d0 d00p0 d01D0 D0S 40$@0,02 20RQ$ $0SE@0,00d0 d00p0 00 d00K zN?K1 ?KN01 00S @0,0 | K "0p$ $0S@0,00d0 d0 @00R ,0S d0 0 0R |00|0 d0K $ $0Sd01 402<S 4020s0S 00@0d0 c2R[P0S P0O$ $0SP0K T$ $0SP000 0 d01 0 @0,00C0 @0,00C010CR 0 d00p0 @000 'p0    0M$ $0S2 20pKlK<K$ $0S@0,00C02 20hK<|K$ $0S0, 000R8O00$0 $0S0,0h  0,0@ ,  B  r 0,0h ! 0,0`0K0,0  0,0 0, $0SZ0, 000R8sO00$0 $0S0,0l  0,0 0,0l ! 0, 000,0  0  0l0 00 0 50 0,000K PM?K1 ?KL01 00S P 0,0|K"0E $ $0S0,000p0 (60 @0,000K &M?K1 ?KL01 P0 t K "2$ $0S|00|0 @0,00Sv d0 p0R't0S#p0S d01 402<S 4020s0S 00@0d0 c2R00Sd00p0 @0 d01 @0 @000 |0S00'P$ $0SP0S P |0S00P$ $0S0d0 p0S 00S0t0 t0S|0S 00S P0O$ $0SP0M$ $0S 0 0@0  |0S 00p @,0-L$ $0Sc2 20pKdK<J$ $0ST0 0 .&$"  0d0 $"  00 20S $0S 000 2S UOL L0S $0SL0$0 P0S P0EOL L0S $0SL0$0 P0LL L0S $0SL0$0 d0S 2 d 20<S0S00L0 L0S $0SL0$0 l0S 2 l 20<S0S00L0 L0S $0SL0$0 t  0 $0KH-0M( , 0 40 (00 0 (000 ,000 0,000 0,000 011K1[Sw 40S 400S (4 06 0S 0l00S 0f(00S 0,00C0S0,00C0SH01 02<S  020s0S 00@00 c01 02<S  020s0S 00@00c 02<S  020s0S 00@0 0`00 00R(,0 0  (,  0KH-MO@  0 00D0 D00H0 D0$1L0 00P0 00T0 P0,00X0 T0,000 0K 1OX011K080 00 0<0 015K0 0S 0 0 0R0K 6 < <0So0 D02<S D020s0S 00@00`0 X01 D02<S D020s0S 00@0X00c 0 00S006K01K0 0D02<S D020s0S 00@0[00000 000S000s0 ?000(0 X00SC0 0D02<S D020s0S "00B0[000000S!0 0D02<S D020s0S "00B0[000000s0 ?000( 0(0 6[80 X00Sx![[6[0cRr1[0` 0 [6[00`00Rd(00(0 80080 0 0D02<S D020s0S 00@0[8000000S#0 0D02<S D020s0S 00@0[8000000s0 ?000( 0(0 80080 ![80 5[R 1[0` 0 [8000`00R (0R*: (0 c0R* 0 c( 0c00R80s 1[01K (00c 0 80s 6[0cs 1[01K![6[01K![5[R:1[S X00S X00 S ![5[R 0 D00$0 T0,00C0 T001 D02<S D020s0S 00@000c 0 $0R2*00 00D02<S D020s0S 00@00000h0 h000s0 ?0 00 0 $0R* 0$0 00S00C0 T0( 0R![5[R<T0,00C0S,T0,00C0S& T0,00C0 T0,00C0D02<S D020s0S "00B000000s0 ?0 $0R n0i![6[0c1K0 0D02<S D020s0S 00@0[00000 1[S 000s0 ?0$ S:081 0S D0 50R50@0 0@0 L00@0 0@0 ![6[0c1K1[S 1[0` 0 [6[0c0`00R 000SL@0SK 0 0D02<S D020s0S 00@0[[ `0000l0 l000S+0K uLl000 l000 0K jL000 000 K K@0D3/p p0s00s0 ?0 $0RC:![6[0c1K1[S 1[0` 0 [6[0c0`00R 0 0D02<S D020s0S 00@0[00000 1[S 000s0 ?0$ Sk*1[Sb 040 40,0 ,000 D0$P0,00 00VJ< <0SXD0$T0,00 00CJ< <0SEP0,00X0 T0,000 0 D02<S D020s0S 00@00`0 0 0D02<S D020s0S 00@00000 010s0S#01S`0 `000R 00S0,0 000 0,0 040 40S 000 0,0 040 000 00S ,0S1[0s0S![1[0CXDF< <0S40SO000 L000S S7S5!,lpha00 00 000 000 ![000s0?0KKXE< <0S 00 00 1[ K  X 0E< <0S X00H   N0<0 1[01K40S 010s0S 0  0E< <0S d 000S000s0?0 0 N< <0SF000 1[0C1K1[S0S" P000S081 0S X00S0/000 00cC< <0S C< <0S00S XF< <0SI< <0KH-M  00 00 0 0$0$0 00(0 00,0 (0,0000 ,0,00x0 t0K rJx013K3[S2 0$(0,00 00H 0S 0$,0,00 00H 0S(0,0000 ,0,00x0 0 x010c80 00SW 000SR 081<SM000S 000H0S 000H0 20S:x0t0 02<S  020s0S 00@0x ! 0p0 x x010X0 80T0 0 0000xx tKXK  0A 0S >00 00  x00 0 001800c0<0 x x010<8 B0  02<S  020s0S 00@0000 0 x0 02<S  020s0S 00@000 00 0 00 00s00cs00s 0 00 0 000 000 x01 0R00!80s00cs 00!00!0s00s 00!x0 !x0x 8 r  r !(000S081 0S 000S0/000 00cLB 0SEB 0S,0(00 ,00R,0(001S+H 0S~,0(0000 ,0,00C000 00 0 x00R0 0 C0 00S00 J 0SZ0x0 0 0 0 00 C0 0SP ,00 00xK$7B 0S=x00 0R00 0 x 00$L 0S,0x0 0S( 00 0 0 0 0 0 0R0 0 C0 00S 00 C0 0KH-M  0 00 00 0040 40$080 00<0 00@0 0 000 <0,0D0 <0, 0!0b10 <0, <0,000 011K@0,00 @0, 0!0b10 @0, @0,000 011K 0R <0,00 008F0 00S@0,00 008F0 00S<0,000 @0,000 00S0 ' 0 00S0  0 00S0 0 00Sq01 402<S 4020s0S 00@000c(0 @0,00 00C0 @0(0 R:00S 00 00402<S 4020s0S 00@000000 0 0 @0,00 01K000s00s002K"[(0R'2[( 0c(0 1[01K01![R*0 0402<S 4020s0S 00@0[00000 01![R00C0S400,0 00C0 T001 402<S 4020s0S 00@000c(0 ( ,0R2*00 00402<S 4020s0S 00@000000 000s0 ?0( 00(0 ( ,0R*(0,0 00S00C0 @0( 0R@0,00 01![R'00C01So 00C0 00C0402<S 4020s0S "00B0@00000 90 0402<S 4020s0S 00@0[00000 1[0C1K0 0402<S 4020s0S 00@0[00000 1[S 000s0 ?0 ,0R1[S X0K F0K Ft0K F0 0 00Sv0 0402<S 4020s0S 00@00000 0S000s00s0 000s00s02K01 402<S 4020s0S 00@00 c2[0R: 0S00p0 0 0t0  00p0 0 0t0 p0s05K000s0V0K00T0 00P0 X0K0 00 <000S081 0SD 00 0 0 >0 0402<S 4020s0S 00@0000H0 02K01 402<S 4020s0S 00@00 c2[0R9:H00 2[0 H00 0 0 ![2[KtK@0 00SE1[01K 0S 000s002K0 0 2[ I0 00S/0 1[0C1K1[S0 0S 0 0 0R<0, <0(0R 0K 0 00S 01S 0 0S 0 0 0R@0, @0(0R 0K 0 00S00S 0S <0,0 C<0,  Z>0 00S@0,0 C@0, 00cL>0 00S@0,0 @0, <0D , 0 0 008H0 00S00S 0 00?0000 00S00C0 @0, 0R01S@0(00 @00R@0(001SD0 00S@0(0000 @0,00C000 00 0 00R0 0 C0 00S00 F0 0 0 0 00SM0SJ @00 00K8>0 00SX00 0R00 0  008yH0 00SG00 0S" 00 0 0 0 0 0 0R0 0 C0 00S 00 C0 0?0 00% <0D , @0 , 00KH-xM` d h l0 0X0 00 000 `000 000 0$0 0 `00$0 d00 0 00K+  02<S 020s0S 00@0[00000 000S 00 0 0 0 0RR00 0 l0S' 00$ ,   ` 0[? 0S0l0 0$`0 `00`dGB 0Sd00 0 0[`  0 0S  02<S 020s0S 00@0[00000 000S0 l0S 000` 0 0S00 0 0`0 `00PK < 0SP00(0 `0 P `00 PG 0S(0Sm 0 00K` E 0S 0l0S' 00$ ,   ` 0> 0Sb0l0 0$`0 `00`dA 0SPd00 0 00 0 L0K ;C0 L0KXKTK h0y 0ST0S L0S L0PD0S%00? 000 0S0[00K 01 [R: 00S 00?, ,0S 0S,00 0KH-Mp t x p000 t0009 h0Kp E 0S 0h0S0h0 t000R h00Sh0 !h0p{=00$p0 p00phKA 0Sp00S p000S~ p081<Syp000S p000H0S p000H0 20Sft00\0 02<S 020s0S 00@0X0 t000St0 02<S 020s0S 00@00@0 t001<0 t0 t0010@0 0 t0010c<0 X t00100X0 p0 h0hhtt \K@K 0*: 0S Xh0 h0  h000 h d0Kht0 00 ;h0  h0d K0$p0 p00ptK@ 0S&t000St00 ! t00  r !t00 !t00d Kh00 S #00S h00Sh0 0S t0 h00p > 0Sp00 0 t00pl< h t0 0S 0x0S 0,00C$0 0$$p0 p00p? 0S 0$000S S >$00 $0002<S 020s0S 00@0$000000 >$00 $0002<S 020s0S 00@0$00000 $00 $0002<S 020s0S 00@0$000000 p00S= p000S8 p081<S3p000S p000H0S p000H0 20S p0 $00$@$$h@  0C 0S 0!$00 $00  h0 0 0,0h  0 0$p0 h p00D0KH-8M( , 0 40 (00 0 0$0 0 0 0$(0 (00,K$K9 0SB 0w 0$(0 $ (00SD 0S 0i 0$(0 (00,K$K9 0S 0W40 ,0R*00S 00 0K0(0 0; 0S000 $0K( s 0S $00,0 ,0S$0S 0$(0 $ (00D 0S 0S00 0S (0 0K:000 0S 0S00 0KH-hMH L P T0 00 00 0D0 D0D0 H000 0@0 L00S(L L02<S 020s0S 00@0P00000 000S0 00 00 0 00 0 L L02<S 020s0S 00@0P00000 00 0 0$H0 H00@K 8 0S@00S;@01S700He7 0S<0K ?H0 H0 00<0K<K<K 9 0S< KD0KH ? <0S 0 <0@0S [@0KH  0SO@00D0 0 D0RI H00S5 H000S0 H081<S+H000S H000H0S H000H0 20SH0 L0LL DP  0A 0S L0 L0  D  0 @0S 0$H0 @ H00B 0S 0S 00 0KH- M  00 0 0 00KB 002<S 0020s0S 00@0[00000 000S0 00 0 0 0R 0[ 0 0S00 0 0S 0[00K01 [R: 0KH-8M $ ( ,0 ,0 000 00$1 0 00S0K $ 0J; 0S 0)0 0R  ,0  0 0 00  (K  $0? 0S 00S  ,0 0KH-dME@P T X P00$0 $00(0 P00,0 ,0,00D0 P00S?T0S. 01KD012K$D0 D0$02<S $020s0S 00@0[000040 ,0 400 ,0 1[01K![2[R,00XX   (X 0:0D0 D0$02<S $020s0S 00>0D00000 0 0 0 000 D01SQ 00H0 ,0,0 D0R $0$P0 D P00A 0S 0D0 $0$P0 P00HKDK6 0SD00S/D0 D0$02<S $020s0S 00<0D000080 800 0 8000 0S,(10#A6?O0 ND0 D0$02<S $020s0S 00>0D00000 0 0 0 000 0Sz 000S 0<0 P0 P00<<XX $ X0v7 X X00 0(X 09 D0S ,0,0 D0R $0$P0 D P00@@ @0S 0S@00 0KaH-XMH L P T0 0$0 @0K 3 0S 0G0 $ K  06 0S(0$0< $0S 0 $0Ku5000 0S 0S0 0 0S 07 0S 0S0 0 0S 00E;0S 0S0 0 0KH- M  000 0 0 00 0, 0D 0( 0@ 0 0< 0 08 0 0 0$ 0 0  0  0$0 5 0S 0 0 H 0KH-(M $ ( ,0 00 0 0 00 00 00 0H 0X 0D 0T 0@ 0P 0< 0L 08 0H 04 0$0 e70 00 0 , 0 ( 0 0 $ 0  (00S 000@ 00 0 0KH-(M  $0 0 0 00K 02<S 020s0S 00@0[00000 000Sa 02<S 020s0S 00@0[000000 00S00 K $ B9 0SA 02<S 020s0S 00@0[0000 0R 0  02<S 020s0S 00@0[0000  0[00K01 [Rw: 0KH-0M $ ( ,0 0K  9 0S 0),0 0 0 `  00 900(  000S0  00  00  00  0  2 00 0 000S00 0  00 00  00 00  00 00  00 0  e2 00 0 000S00  000  000  000  00  <2 000S0 0  0 00  0 00  0 00  0 00 2 00 0 000S0K  0K0  0K0  0K0  0K  10  00 0 $0S $0 0 00 $ [4 000S0K  0K0  0K0  0K0  0K  10  00 0 000S00  000  000  000  00  1 000S00  000  000  000  0 00 b1 00 0 000S0K  0K0  0K0  0K0  0K  >10  00 0 000S0$0  0$00  0$00  0$00  0$0  1 000S0(0  0(00  0(00  0(00  0( 00 0 00 0 000S0,0  0,00  0,00  0,00  0,0  0 00 0 000S0K  0K0  0K0  0K0  0K  00 0 00 0 000S040  0400  0400  0400  040  p0 000S080  0800  0800  0800  08 00 G0 00 0 000S0K  0K0  0K0  0K0  0K  #00 < 00 0 0@0 7 000S0D0  0D00  0D00  0D00  0D0  / 00 0 0 @ 0D0 0 0 000S$0S $00S $00@ 0D0 0~6 0S 0, 000S0\0  0\00  0\00  0\00  0\0  / 00 0  0 0KH-Mp t x |0 0\0 \0\0 p000 x0X0 >0h0 00 00 |00Sp029S t0S000 00 t0S0l0 T0KL0 0P0 P0T0 ;t0@0S h0t W4 0S 0t0 00 00L0 t0000@0S 0 0t00,0 0 000 0 0S00 0 00S 00S 0X0 t0 0l0 p0P0 0sp39 0S 0E$0S $00H0H0D0 00S 000D 3/ D 00D0 0St0S D H0K 5 0S 0D0 \0K 5 0S 0\00H0 0S H D00c0 5H0 0 000Sh0K0 0 00h K 00h K 00h K h0K  . 00 0 000Sl0K0 0 00l K 00l K 00l K l0K  . 00 0 000SL00 0 00L  00L  00L  L0  h.000S 00L   00L   00L   00L   0 L00 ?. 00 0 p0P0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  . 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  - 00 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S p Q20S000 0S 0000S00 0 00  00  00 0  -000S 00   00   00   00  0 00 k-  P4 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  @- 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 10S000 0S 00000S00 0 00  00  00 0  ,000S 00   00   00   00  0 00 ,  3 00 0 000S00 0 00  00  00 0  , 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  k, 00 0 0S t0S2 00<0,0 0 ,000R 0 ,000R030#s00 ,040R 0 ,040R:00s0S p 00S000 0S 0[000S00 0 00  00  00 0  ,000S 00   00   00   00  0 00 +  2 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  + 00 0 $0S&0`0 000S`0K0 0 00` K 00` K 00` K `0K  + 00 0 I000S$000 0 00$   00$   00$  $00  g+ 00 0 $0 $00  \+000S$00 p  01 0S 0t$00 0 0 000S(00 0 00(  00(  00( (0  "+ 00 0 0St0SX|00H K 3 0S0t0S* L0X X x0R$ X x0 00 \0t P 0S\0 t0T \ t0P t0 0t  `  ` x0 x0  0St0SH020KH-0M $ ( ,0 0K  1 0S 0C,0 0 0 `  00 100(  000S0  00  00  00  0  * 00 0 000S00 0  00 00  00 00  00 00  00 0  _* 00 0 000S00  000  000  000  00  6* 000S0 0  0 00  0 00  0 00  0 00 * 00 0 000S0K  0K0  0K0  0K0  0K  )0  00 0 $0S $0 0 00 $ U, 000S0K  0K0  0K0  0K0  0K  )0  00 0 00 0 000S00  000  000  000  00  ) 00 0 0  00 0 0 000S$0S $00S $00 00 0 0 0S 0 000S0K  0K0  0K0  0K0  0K  4)0 4 00 0 000S0K  0K0  0K0  0K0  0K  )0 8 00 0 0<0 / 000S0@0  0@00  0@00  0@00  0@0  ( 00 0 0 < 0@0 0 0 000S0X0  0X00  0X00  0X00  0X0  ( 000S0\0  0\00  0\00  0\00  0\ 00 ( 00 0  0 0KH-xMh l p t0 0T0 T0T0 h000 p0P0 ?0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l 7- 0S 0dl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0sh2 0S 0*0S 00( ( 0S 00000<0 00S 000< 3/ < 00<0 0Sl0S < @0K . 0S 0<0 T0K . 0S 0T00@0 0S @ <00c0 .@0 0 000S`0K0 0 00` K 00` K 00` K `0K  ' 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  c' 00 0 000SD00 0 00D  00D  00D  D0  ?'000S 00D   00D   00D   00D   0 D00 ' 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  & 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  & 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  & 00 0 I000S000 0 00   00   00  00  u& 00 0 0 00  j&000S00 h  0 - 0S 000 0 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  .& 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  & 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  % 00 0 5000S000 0 00   00   00  00  % 00 0 0 00  %00 0 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h *0S000 0S 0000S00 0 00  00  00 0  K%000S 00   00   00   00  0 00 "%  , 00 0 0Sl0SPt00@ K- 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0,0KH-(M  $0 0K + 0S 0$0 0 0 ,  00 +00  000S0  00  00  00  0  $ 00 0 000S00 0  00 00  00 00  00 00  00 0  Z$ 00 0 000S00  000  000  000  00  1$000S0 0  0 00  0 00  0 00  0 00 $ 00 0 000S0K  0K0  0K0  0K0  0K  #0  00 0 0S 0 0 00 P& 000S0K  0K0  0K0  0K0  0K  #0  00 0 000S00  000  000  000  00  #000S00  000  000  000  0 00 W# 00 0 000S0 0  0 00  0 00  0 00  0 0  .# 00 0 000S0$0  0$00  0$00  0$00  0$0  # 00 0 000S0(0  0(00  0(00  0(00  0(0  " 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 70\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l ' 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0shn, 0S 0f,0<0 00S 000< 3/ < 00<0 0Sl0S < @0K 9) 0S 0C<0 T0K ,) 0S 06T00@0 0S @ <00c0 (@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  ! 00 0 000S`0K0 0 00` K 00` K 00` K `0K  ! 00 0 000SD00 0 00D  00D  00D  D0  !000S 00D   00D   00D   00D   0 D00 ! 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  Y! 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  3! 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h %0S000 0S 0 000S00 0 00  00  00 0  000S 00   00   00   00  0 00   ' 00 0 000S 00 0 00  00  00  0  00 0 000S00 0 00  00  00 0  ` 00 0 000S00 0 00  00  00 0  < 00 0 0Sl0SPt00@ K:( 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0 (0KH-(M  $0 0K & 0S 0$0 0 0 ,  00 &00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  y 00 0 000S00  000  000  000  00  P000S0 0  0 00  0 00  0 00  0 00 ' 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 o! 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 v 00 0 000S0 0  0 00  0 00  0 00  0 0  M 00 0 000S0K  0K0  0K0  0K0  0K  )0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0   00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 80\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l " 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh' 0S 0h,0<0 00S 000< 3/ < 00<0 0Sl0S < @0K Z$ 0S 0E<0 T0K M$ 0S 08T00@0 0S @ <00c0  $@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S`0K0 0 00` K 00` K 00` K `0K   00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  z 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  T 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0 000S00 0 00  00  00 0  000S 00   00   00   00  0 00   " 00 0 000S 00 0 00  00  00  0   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S00 0 00  00  00 0  [ 00 0 0Sl0SPt00@ KY# 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0)#0KH-(M  $0 0K ! 0S 0$0 0 0 $  00 !00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  o000S0 0  0 00  0 00  0 00  0 00 F 00 0 000S0K  0K0  0K0  0K0  0K  "0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00  00 0 000S0 0  0 00  0 00  0 00  0 0  l 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 90\0 00 00 t00Sh029S l0S0x0 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l " 0S 0Xl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh" 0S 0$0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0<0 T0K  0S 0T00@0 0S @ <00c0 @0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S`0K0 0 00` K 00` K 00` K `0K  ^ 00 0 000SD00 0 00D  00D  00D  D0  :000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h #0S000 0S 0000S00 0 00  00  00 0  f000S 00   00   00   00  0 00 =  " 00 0 000S 00 0 00  00  00  0   00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@00KH-(M  $0 0K  0S 0z$0 0 0 h  00 00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  Q 00 0 000S00  000  000  000  00  (000S0 0  0 00  0 00  0 00  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 G 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  w000S00  000  000  000  0 00 N 00 0 000S0 0  0 00  0 00  0 00  0 0  % 00 0 000S0$0  0$00  0$00  0$00  0$0   00 0 0(0 000S0,0  0,00  0,00  0,00  0,0   00 0 0 ( 0,0 0 0 0D0 000S0H0  0H00  0H00  0H00  0H0   00 0 0 D 0H0 0 0 000S0`0  0`00  0`00  0`00  0`0  e 00 0 000S0d0  0d00  0d00  0d00  0d0  < 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 :0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l  0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0sh 0S 0Z0S 000 0 0S 00000<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0'<0 T0K | 0S 0T00@0 0S @ <00c0 O@0 0 000S`0K0 0 00` K 00` K 00` K `0K  B 00 0 000Sd0K0 0 00d K 00d K 00d K d0K   00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0000S00 0 00  00  00 0  &000S 00   00   00   00  0 00    00 0 000S 00 0 00  00  00  0   00 0 000S00 0 00  00  00 0   00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 5000S000 0 00   00   00  00  ] 00 0 0 00  R00 0 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  ' 00 0 5000S000 0 00   00   00  00   00 0 0 00  00 0 0 000S00 0 00  00  00 0   00 0 000S 00 0 00  00  00  0   00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0v0KH-(M  $0 0K L 0S 0$0 0 0 $  00 "00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00  00 0 000S0K  0K0  0K0  0K0  0K  o0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  70  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00  00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 ;0\0 00 00 t00Sh029S l0S0z0 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l q 0S 0Zl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0shM 0S 0 $0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0<0 T0K  0S 0T00@0 0S @ <00c0 @0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00 ` 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  8 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S h L0S000 0S 0000S 00 0 00  00  00  0  000S 00   00   00   00  0 00 f   K 00 0 0Sl0SPt00@ K_ 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0/0KH-(M  $0 0K  0S 0$0 0 0 0  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  u 000S0 0  0 00  0 00  0 00  0 00 L 00 0 000S0K  0K0  0K0  0K0  0K  ( 0  00 0 0S 0 0 00   000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  { 0  00 0 000S0$0  0$00  0$00  0$00  0$0  O 00 0 000S0(0  0(00  0(00  0(00  0(0  & 00 0 000S0,0  0,00  0,00  0,00  0,0  00 0  0 0KH-hM` d h l0 0P0 P0P0 `000 h0L0 @0X0 00 00 l00S`029S d0S00 0 0 0 d0S0\0 H0K@0 0D0 D0H0 ;d0@0S X0d  0S 0d0 00 00@0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0L0 d0 0\0 `0P0 0s` 0S 0M0080 00S 0008 3/ 8 0080 0Sd0S 8 <0K Z 0S 0*80 P0K M 0S 0P00<0 0S < 800c0  <0 0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S@00 0 00@  00@  00@  @0  000S 00@   00@   00@   00@   0 @00  00 0 `0P0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  z 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  T 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  . 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 000S00 0 00  00  00 0   00 0 000S00 0 00  00  00 0   00 0 000S00 0 00  00  00 0  v 00 0 0Sd0SLl00< Kt 0S0d0S* @0L L h0R$ L h0 00 P0d P 0SP0 d0T P d0P d0 0d  `  ` h0 h0   0Sd0S<0D0KH-(M  $0 0K  0S 0$0 0 0 $  00 00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 a 00 0 000S0K  0K0  0K0  0K0  0K  =0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0   00 0  0 0KH-hM` d h l0 0P0 P0P0 `000 h0L0 A0X0 00 00 l00S`029S d0S090 0 0 0 d0S0\0 H0K@0 0D0 D0H0 ;d0@0S X0d A  0S 0d0 00 00@0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0L0 d0 0\0 `0P0 0s` 0S 0$080 00S 0008 3/ 8 0080 0Sd0S 8 <0K  0S 080 P0K  0S 0P00<0 0S < 800c0  <0 0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  } 00 0 000S@00 0 00@  00@  00@  @0  Y000S 00@   00@   00@   00@   0 @00 0 00 0 `0P0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 000S00 0 00  00  00 0  r 00 0 0Sd0SLl00< Kp  0S0d0S* @0L L h0R$ L h0 00 P0d P 0SP0 d0T P d0P d0 0d  `  ` h0 h0   0Sd0S<0@ 0KH-(M  $0 0K   0S 0Z$0 0 0 8  00 00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 ] 00 0 000S0K  0K0  0K0  0K0  0K  90  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0$0  0$00  0$00  0$00  0$0  \000S0(0  0(00  0(00  0(00  0( 00 3 00 0 000S0K  0K0  0K0  0K0  0K  0 , 00 0 000S000  0000  0000  0000  000  000S040  0400  0400  0400  04 00 00 0  0 0KH-(M  $0 0K  0S 0/$0 0 0 4  00 |00  000S0  00  00  00  0  m 00 0 000S00 0  00 00  00 00  00 00  00 0  ? 00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 5 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  j0  00 0 000S0K  0K0  0K0  0K0  0K  C0  00 0 000S0 0  0 00  0 00  0 00  0 0  000S0$0  0$00  0$00  0$00  0$ 00 00 0 000S0K  0K0  0K0  0K0  0K  0 ( 00 0 000S0,0  0,00  0,00  0,00  0,0  000S000  0000  0000  0000  00 00 u 00 0  0 0KH-pMh l p t0 0X0 X0X0 h000 p0T0 0`0 00 00 t00Sh029S l0S0Q0 0 0 0 l0S0d0 P0KH0 0L0 L0P0 ;l0@0S `0l + 0S 01l0 00 00H0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0T0 l0 0d0 h0P0 0sh 0S 040@0 00S 000@ 3/ @ 00@0 0Sl0S @ D0K  0S 0@0 X0K  0S 0X00D0 0S D @00c0 D0 0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 000Sd0K0 0 00d K 00d K 00d K d0K  g 00 0 000SH00 0 00H  00H  00H  H0  C000S 00H   00H   00H   00H   0 H00  00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0N000S00 0 00  00  00 0  #000S 00   00   00   00  0 00    00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S l0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S h /0S000 0S 0000S00 0 00  00  00 0  r000S 00   00   00   00  0 00 I  . 00 0 0Sl0STt00D KB 0S0l0S* H0T T p0R$ T p0 00 X0l P 0SX0 l0T X l0P l0 0l  `  ` p0 p0   0Sl0SD00KH-(M  $0 0KF  0S 0$0 0 0   00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  X000S0 0  0 00  0 00  0 00  0 00 / 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 w 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 ~ 00 0 000S0K  0K0  0K0  0K0  0K  Z0  00 0 000S0$0  0$00  0$00  0$00  0$0  .000S0(0  0(00  0(00  0(00  0( 00  00 0 0,0 000S000  0000  0000  0000  000  00 0 0 , 000 0 0 0H0 000S0L0  0L00  0L00  0L00  0L0  00 0 0 H 0L0 0 0 0d0 x000S0h0  0h00  0h00  0h00  0h0  h 00 0 0 d 0h0 0 0  0 0KH-0M $ ( ,0 0K  L 0S 0,0 0 0 h  00 "00(  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  o0  00 0 $0S $0 0 00 $  000S0K  0K0  0K0  0K0  0K  70  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0$0  0$00  0$00  0$00  0$0  000S0(0  0(00  0(00  0(00  0( 00 i 00 0 0,0 J 000S000  0000  0000  0000  000  : 00 0 0 , 000 0 0 0H0  000S0L0  0L00  0L00  0L00  0L0   00 0 0 H 0L0 0 0 000S$0S $00S $00,00 0H0 0S 0* 000S0K  0K0  0K0  0K0  0K  0 d 00 0  0 0KH-Mp t x |0 0X0 X0X0 p000 x0T0 0d0 00 00 |00Sp029S t0S000 00 t0S0h0 P0KH0 0L0 L0P0 ;t0@0S d0t m 0S 0t0 00 00H0 t0000@0S 0 0t00,0 0 000 0 0S00 0 00S 00S 0T0 t0 0h0 p0P0 0spI 0S 00S 004 4 0S 00000@0 00S 000@ 3/ @ 00@0 0St0S @ D0K  0S 0@0 X0K  0S 0X00D0 0S D @00c0 D0 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000Sh0K0 0 00h K 00h K 00h K h0K  00 0 000SH00 0 00H  00H  00H  H0  u000S 00H   00H   00H   00H   0 H00 L 00 0 p0P0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  $ 00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S p ^0S000 0S 0X000S00 0 00  00  00 0  000S 00   00   00   00  0 00 x  ] 00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  M 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 0S000 0S 0000S00 0 00  00  00 0  000S 00   00   00   00  0 00   00 0 0S&0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 I000S000 0 00   00   00  00  o 00 0 0 00  d000S00 p  0 0S 000 0 0 0S&0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  % 00 0 E000S000 0 00   00   00  00  00 0 0 00  000S 000s0S 0000 0 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 0St0ST|00D K 0S0t0S* H0T T x0R$ T x0 00 X0t P 0SX0 t0T X t0P t0 0t  `  ` x0 x0  0St0SD00KH-(M  $0 0K \ 0S 0$0 0 0 ,  00 200  000S0  00  00  00  0  # 00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  G0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 00 0 000S0 0  0 00  0 00  0 00  0 0  00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 000S0K  0K0  0K0  0K0  0K  ~0 ( 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 0\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l 1 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh  0S 0j,0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0G<0 T0K  0S 0:T00@0 0S @ <00c0 @0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 000S`0K0 0 00` K 00` K 00` K `0K  m 00 0 000SD00 0 00D  00D  00D  D0  I000S 00D   00D   00D   00D   0 D00 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 20S000 0S 0 000S00 0 00  00  00 0  u000S 00   00   00   00  0 00 L  1 00 0 000S 00 0 00  00  00  0  # 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@00KH-MB@  t20 >0$ 0S 0D20 ?0 0S 020 70  0S 0u10 80 0S 0h10 90 0S 0[10 :0 0S 0NT10 ;0 0S 0A$10 @0 0S 0400 A0 0S 0'00 0 0S 000 0 0S 0 d00 0 0S 00K萢h8L((H-M Z 0S 0p 0S S 0S 0S 00 0KH-MB@ 000 0Kd 4 0S 0m 00 0<0  0S 00Z0 0 0`! ! 0! 0 0D! ! 0! 0 0(! ! 0! 0 0 ! ! 0 ! 0 0  ! 0! 0 0  ! 0! 0 0  ! 0! 0 0  ! 0  ! 0  $! 0x  (! 0l  ,! 0`  0! 0T  4! 0K,u c,j4fo\$H-@M0 4 8 00 000$00 00 0 0 0(0 0000 0000S{ 0 0S0 0 00 00027S 0000000s0S 00 0 0ST00 000002<S 00020s0S "00B00000 0 00S 004 K 040 00 1 4( K3/ 0S(0S 000 0000 0S 0 0S00S 00 0 000,$ $0S 0S$00 0S 0$ $0S 0S$00 0$ $0S 0S$00 0KH-M 000 0<0S 0 0<0X00S0KH-0M0 4 0000 0$00 0000 00 0 0S 00!001R:40 00 0002<S 020s0S "00B000000S S Sv00 |00 0002<S 020s0S "00B0000000 01s00s000 02<S 020s0S 00>0000   ",R  " r R "  B   0bs00Cs0 0 0 &0K 2[0 00 000   0R:0 0 0 40  00 0 000$ $0S 0S$0 0 0  0KH-@M8 800 0 0$00 8000 0`00S 6?O8 0S8- 0S00 00 02<S  020s0S "00B000000S 080 8008M 0S0`00S 04SI0401s0800s000 02<S  020s0S 00>0000   ",R  " r R "  B   0bs00Cs0Q8 [00 0 00 04$0 040(0 000 0 00 02<S  020s0S "00B00000040 40K8  0S%0$040cs00Cs 0$0`0 0` 0408 0 8 00S 80 0 800 0S 0S00 0  8 0S 0S00 0K-M  000 00 0 0@ 0@ 0D 0D 0$ 0$0$ 0$0$ 0$0`00S 0`0 0` 0`00S 0`0 0` 0Ћ/pH-0[000T0 ",R 0 " r R  @ [  0bs00Cs0x0 1[0X 00 T010c H00c000 T T002<S 0020s0S "00B0[0000\0 \000CSL$0S" 00 T014 0c|0 |0R*1[So 1[0C1KT T002<S 0020s0S "00B0[0000d0 d00SA1[s40s0T 002<S 0020s0S 00>0[000T0 ",R 0 " r R "  B [  0bs00C1K1[0Kd00j K z0 0 06K00K01K<0`0 <0` l&[<0$<0 [$<0![$p0KP , ,0SS , 6?OR ,00 <0 008, ,0S ,0<0  <0@0S01K<0![!8, ,0S ,0<0@0 C<0@ <0@@<08P<0@00001 <0 <0 !, ,0S ,0p0KP /, ,0S ,0<011Kt L0R*081;S 0 |0 00c?0?0 06?Ov0(0 T01T  |0 0$0 |00c0 |000 <0`00S 0 0 <046K<040K<041KS\00SG0 0 <0`0 <0` 00K\00j K 1[s40s0T 002<S 0020s0S 00>0[000T0 ",R 0 " r R "  B [  0bs00C1K0 0 06K00K01K @0S 000c0 @0S 00| 0|0 0 0R* 0Sr 0[So t000s0 [0cs00C0KE@0S t0  0Ct0 t0x  0Ct0 0S+ t0![ X T ! b H  b [  0Ct0 0[0\ 0j K ,&[0[0s000Kt0&[ 0Ct0 Nt0![ X T ! b H  b 0Ct0 t0![r4 r T0 ",R 0 " r R   > [  T0Q 0qQ "B[  ar  Br 0Ct0 0S [1[R*D0SC <0`0 <0` \00p K 00C0 0 0R:@0S 00C0 0 0R:t0  0Ct0 t0x  0Ct0 t0`0 p @0S t000tKKKD H , ,0Se , 6?OR0|0 00 @0S] t0` R[t00t0 x,0 @0S 000c0 0 0Re:\00| K X\00p K Q| 0RU|p 06, ,0S ,0@0S t0  0Ct0 t0x  0Ct0 t0 H  b 0Ct0 t0|  0Ct0 |000 |00c0 (0S 1[01KT01![R:<0![!&[<0$<0 [$<0![$,0Sv(0Ss T01![Rn:p0KP y, ,0S , 6?OR ,0b00$0 <0 00, ,0S ,0R<0  d, ,0S ,0G<0@0 <0@ <0@ <080H0R<0@0 C<0@ 6?O,0 <0@@<08P<0@00;001 <0 <0 !<0`0 <0` p0KP ", 5h h0S h0 ,0S} , 6?OR ,0t0 0 K0H-TME@H L P T0 00 H000 0$00 H00 0 0`00S T0 S T0S 6?OMH 0SET0S T0#J0S:0@0S L0 0800#1RL00  P0 0800#1QP00000$0 00HL$ 0  6?ORY 0T0S 0T 0 0R H0  0 H00 0S 0  0T 0 0 !P00 0S+ P00S' 0P0 P00 H0d0HlDK 0SD P00 D P00P0 P00 D0K0 P00 HL 0 pT0S& 0`00S#00S6?O0 00H 0S VH B 00X20T   0 T 0 %00S70S4 0H0 H00H 0S"T0S T0 S T0S T0S020S L000SHPT G HPT 0 00S H0  0 H00( (0S 0S(00 (0S 0  0S 0`00S H% 0`0 0` 0S H00S00 H( (0S 0S(00 0KvapH-Mp p00$0 $0$0(0 p00,0 p 0S 00T0 ,080D0 D00h0 0`0 00 00 ,080H0000 ,080P 00040 ,080H ,080L0R0080 0^< 80S ,080<   1S ,08@000L00!000d0 p0 p00dK`K( 0S` \0K/$023S 0h0 h0 T K p 0 0Sp0 p00hKDK( 0S00 D0 00d0 0\0 0X0 00 p00SC p000S> p081<S9p000S p000H0S p000H0 20S&p0 ,080H`hPD0@,080,080dD0 \0K`P@ \K $ 0 0S 0\0 0X0 ,080\ K80SG ,080<   1S?,080H d00d0 p0 p00dK`K(J 0S\,080<  d0a,8Ha D0d  D0\ K`0d  `0 `0  `0 !`0$  r !`0  `0  `0\ Kp0 ` p00( 0S$0`0 ,0800 H 80S ,080, 8 L P ,080, 8 P0  L p40  0S p0 D p00(S@ @0S 0S@0 0 T0S T0KpK00@0 @0S 0S@0 0 `0S p0 ` p00(-@ @0S 0S@0 0 0KpH-(M $ ( 00 0 000 0(10 0 0 $( 3/ 080L 000 080H 0R*080P0 00 0KH-pMX \ ` X00 0 X000 0101K00 00 02<S  020s0S 00@0[000000K000 \00 0[S `0S `0 S `0 S 00`00S0[S0`0 0` 01s0800s000 02<S  020s0S 00>0000   ",R  " r R "  B   0bs00Cs 0$00 00 02<S  020s0S "00B000000 `0S `0S `0S%0 $040 0N K z0$4[0s00s 0$0$04R:0$4[0cs00Cs 0$ 00N K Z0 $$[0$`0S `0 S `0 S0`00S `0 S0`0 0` D KL0K`X\0`0 0` D0s 0$00 00 02<S  020s0S "00B000000 00S%00H K 00@ K X0 X00@H LK   \0 0SX 000<0 01s 00s000 02<S  020s0S 00>0000   ",R  " r R "  B   0bs00Cs080 00S<0K \ 0 00< K \ 3/0L0 L0S 6?OhX0810S\000S 0\0`00S. <0K\ r$0 0S , 04R000 0 ,0 04R04 ,00c00 $0 0$0 0400 0,0 , 0400,0 <0K0 X0 X00[X(X(   0I 0S 0 0 \0 0 \0 \00 \0 0KH-MJ@x | x000 000 x00 0 0`00S! |00 0S[ L0K L0Kx $ $0S $0H0(0 (0s06K|0 (0R|00s (0s00cs |00s00s 6[0s06K$|0 |0 0 (0R|00s |00s(0s00cs00s 6[0s06K |00s |0 0s00cs 6[0s06K 04 (0 c6[ 0800#1Rxk$ $0S $0< 000 00 | 00 000   ",R  " r R "  B   0bs00Cs0@0 L0K0 |00 x 0K`a0H- 0M( , 0 40 (000 (000 ( 0S 000 P ,00 ,00( s 0@ 0@@08P0@00001 0 (4 0S 00 0!?R0 !0`0 0` 0P0S( 0T0S$0P 00102<S 020s0S 00@000cR*0 0T 0 %00  $K (, 0 0S 0^0T 0 0R0!0%$0S.0`0 0` 00 0002<S 020s0S "00B000000 00S00 0"000S 000 0 0 !( ) 0S 0 0 0Sj0`0@ 0` 6?O K0H-M   0  K0 0R*  0S 0 0 0  0 0 0  0KH-hM@ D H L0 @00 0 00$0 @00(0 @00S @000S @000,0 00 $0H0S $0H0$0S 7?OH00CS 00 00 00 00 00 00 00 00 000 0S 00 00000 0000S 0000L 0L0R 00 s 0(0S 0(0$0S 7?Oi00 0 K @0RA 00S? 0000 00`00S8 (0 00 0R2(0!001R,00\ 0R':L0S (0$004R 00S 000:S 00 0S 00 0 0S00\000  00 0 0S 0(0S 0(0$0S 7?O000 0S 0L 0L0R (0 \ 00 00000 0000S 0000L 0L0R  0(0S 0(0$:0S 7?O00 0 \ @0RB 00S@ 0000 00 (0 0R900!?R6 00S 000:S 00 0S 00 0 x0S!,0S 0 ,0R 00 L0Sq0S700!(01R$00`00S 00\ (0\0R00`0 00` 00\ (0\0R00\ (0\0 c00\ 0010s 00!00!(01R:0010s 00!00!(01R0010Cs 00!00!(01R00`00S 00\ 0 00\ 00!(01R00`00S00`0 00` 00`0 00` 00 \ 00!(01R0SR00$D0s00s 00$00$(04R,(0`00S' 00`00S" 00\ (0\0R00`0 00` 00\ (0\0Ru00\ (0\00c 00\ 00$D0s00s 00$i00$(04R0S]00$(04RY00$D0s00s 00$Q00$D0s00cs 00$00$(04R00$D0s00cs 00$00$(04R500`00S0 00\ 0 00\ )0S&00$(04R 00`00S00`0 00` 00 \   00 0 0S 0(0S 0(0$Z0S 7?O^000 0S 0L 0L0Rq $0H0S $0H0$?0S 7?OC0S? @00S; @000S6 @081<S1@000S @000H0S @000H0 20S(0 (01(04H <0KD  L    , 04 40S 400KH-(M $ ( ,0 ,0 000 00 00 0H0S 0H0E0S 7?O 00 00000 0000Sy 0000L 0L0R o 0(0S 0(00S 7?O00 0 E 00 $0R<( ?R 001 (0R1 00S 000:S 00 0S $c0S 0R:0 00 0 01, # 0S\,0 010  000 00 0 0S 0(0S 0 0(0S0S 7?O]000 0S 0L 0L0R 0H0S 0H080S 7?OB,0S  0R:000 0 01,  0S 0*,0 010 0! 0(0S 0 0(00S 7?O0H0S 0H00S 7?O0KH- M 081 0S  0000s0S 000S0) 00 0 00 00S 0$0S 0K0 / 0S0S 0S 0 0K`000 0KH-(M  $0 0K  0S 0($0 0 0 `  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  t000S0 0  0 00  0 00  0 00  0 00 K 00 0 000S00  000  000  000  00  " 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 j 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  00 0 000S0 0  0 00  0 00  0 00  0 0  q000S0$0  0$00  0$00  0$00  0$ 00 H 00 0 0(0 )000S0,0  0,00  0,00  0,00  0,0   00 0 0 ( 0,0 0 0 0D0 000S0H0  0H00  0H00  0H00  0H0  00 0 0 D 0H0 0 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 0`0 00 00 t00Sh029S l0S0k00 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l  0S 0Kl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0shl 0S 00S 000 0 0S 0000<0 00S 000< 3/ < 00<0 0Sl0S < @0K ( 0S 0<0 T0K  0S 0T00@0 0S @ <00c0 @0 0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00 p 00 0 000S00 0 00  00  00  0 L 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  $ 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 000S 00 0 00  00  00  0  00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h :0S000 0S 0]000S00 0 00  00  00 0  }000S 00   00   00   00  0 00 T  9 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  & 00 0 5000S000 0 00   00   00  00  00 0 0 00  00 0 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 5000S000 0 00   00   00  00  00 0 0 00  00 0 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0]0KH-(M  $0 0K 3 0S 0$0 0 0 <  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 z 00 0 000S00  000  000  000  00  Q 00 0 000S0K  0K0  0K0  0K0  0K  -0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  |0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0  P000S0,0  0,00  0,00  0,00  0, 00 ' 00 0 000S0K  0K0  0K0  0K0  0K  0 0 00 0 000S040  0400  0400  0400  040  000S080  0800  0800  0800  08 00 00 0  0 0KH-xMp t x |0 0\0 \0\0 p000 x0X0 0d0 00 00 |00Sp029S t0S00 0 0 0 t0S0h0 T0KL0 0P0 P0T0 ;t0@0S d0t d 0S 0t0 00 00L0 t0000@0S 0 0t00,0 0 000 0 0S000 00S00S0X0 t0 0h0 p0P0 0sp@ 0S 0<0D0 00S 000D 3/ D 00D0 0St0S D H0K  0S 0]D0 \0K  0S 0P\00H0 0S H D00c0 H0 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000Sh0K0 0 00h K 00h K 00h K h0K  00 0 000SL00 0 00L  00L  00L  L0  |000S 00L   00L   00L   00L   0 L00 S 00 0 000S00 0 00  00  00  0 / 00 0 p0P0 0`0 000S`0K0 0 00` K 00` K 00` K `0K   00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S p A0S000 0S 0000S 00 0 00  00  00  0  000S 00   00   00   00  0 00 [  @ 00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  0 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 0S000 0S 0N000S00 0 00  00  00 0  000S 00   00   00   00  0 00   00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K   00 0 0S t0S2 00<0,0 0 ,000R 0 ,000R030#s00 ,040R 0 ,040R:00s0S p 0S000 0S 0000S00 0 00  00  00 0  "000S 00   00   00   00  0 00   00 0 0St0SX|00H K 0S0t0S* L0X X x0R$ X x0 00 \0t P 0S\0 t0T \ t0P t0 0t  `  ` x0 x0   0St0SH00KH-0M $ ( ,0 0K   0S 0,0 0 0 @  00 n00(  000S0  00  00  00  0  _ 00 0 000S00 0  00 00  00 00  00 00  00 0  1 00 0 000S00  000  000  000  00   000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 $0S $0 0 00 $ ' 000S00  000  000  000  00  ~ 00 0 000S0K  0K0  0K0  0K0  0K  Z0  00 0 00 8 000S0 0  0 00  0 00  0 00  0 0  ( 00 0 0  0 0 0 0 000S$0S $00S $00 0 0 0 0S 0U 000S080  0800  0800  0800  080  000S0<0  0<00  0<00  0<00  0< 00 00 0  0 0KH-xMh l p t0 0T0 T0T0 h000 p0P0 0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l e 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0shA 0S 0 0S 00(0(0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0o<0 T0K  0S 0bT00@0 0S @ <00c0 @0 0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000SD00 0 00D  00D  00D  D0  v000S 00D   00D   00D   00D   0 D00 M 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  % 00 0 000S00 0 00  00  00  0  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 I000S 000 0 00   00   00   00  00 0 0 00  }000S 00 h  0  0S 0 00 0 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0000S00 0 00  00  00 0  000S 00   00   00   00  0 00   00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@00KH-(M  $0 0K  0S 0O$0 0 0 d  00 V00  000S0  00  00  00  0  G 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  k0  00 0 000S00  000  000  000  00  ? 00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 0(0 000S0,0  0,00  0,00  0,00  0,0  00 0 0 ( 0,0 0 0 0D0 p000S0H0  0H00  0H00  0H00  0H0  ` 00 0 0 D 0H0 0 0 000S0`0  0`00  0`00  0`00  0`0  / 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l  0S 0rl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0sh 0S 080S 000 0 0S 00000<0 00S 000< 3/ < 00<0 0Sl0S < @0K | 0S 0<0 T0K o 0S 0T00@0 0S @ <00c0 B@0 0 000S`0K0 0 00` K 00` K 00` K `0K  5 00 0 000Sd0K0 0 00d K 00d K 00d K d0K   00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00 ľ 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  㜾 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  v 00 0 000S00 0 00  00  00 0  R 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S h 0S000 0S 0000S 00 0 00  00  00  0  000S 00   00   00   00  0 00 ̽  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  㡽 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  x 00 0 5000S000 0 00   00   00  00  N 00 0 0 00  C00 0 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 5000S000 0 00   00   00  00  00 0 0 00  00 0 0 000S00 0 00  00  00 0  㽼 00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@00KH-0M $ ( ,0 0K  a 0S 0,0 0 0 T  00 700(  000S0  00  00  00  0  ( 00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  ѻ 000S0 0  0 00  0 00  0 00  0 00 㨻 00 0 000S0K  0K0  0K0  0K0  0K  ㄻ0  00 0 $0S $0 0 00 $  000S0K  0K0  0K0  0K0  0K  L0  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 00 0 000S0K  0K0  0K0  0K0  0K  Ӻ0  00 0 000S0$0  0$00  0$00  0$00  0$0  㧺 000S0(0  0(00  0(00  0(00  0( 00 ~ 00 0 000S0K  0K0  0K0  0K0  0K  Z0 , 00 0 000S000  0000  0000  0000  000  . 000S040  0400  0400  0400  04 00  00 0 080 000S0<0  0<00  0<00  0<00  0<0  ֹ 00 0 0 8 0<0 0 0 000S$0S $00S $008 0<0 0c 0S 0 0 0KH-Mp t x |0 0\0 \0\0 p000 x0X0 0h0 00 00 |00Sp029S t0S010 0 0 0 t0S0l0 T0KL0 0P0 P0T0 ;t0@0S h0t e 0S 0t0 00 00L0 t0000@0S 0 0t00,0 0 000 0 0S000 00S00S0X0 t0 0l0 p0P0 0spA 0S 00S 00<0<0D0 00S 000D 3/ D 00D0 0St0S D H0K  0S 0D0 \0K  0S 0\00H0 0S H D00c0 ˿H0 0 000Sh0K0 0 00h K 00h K 00h K h0K  㾸 00 0 000Sl0K0 0 00l K 00l K 00l K l0K  㚸 00 0 000SL00 0 00L  00L  00L  L0  v000S 00L   00L   00L   00L   0 L00 M 00 0 p0P0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  % 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S p _0S000 0S 0s000S00 0 00  00  00 0  㢷000S 00   00   00   00  0 00 y  ^ 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  N 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 宻0S000 0S 0000S00 0 00  00  00 0  000S 00   00   00   00  0 00 ȶ  㭽 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  㝶 00 0 0S t0S2 00<0,0 0 ,000R 0 ,000R030#s00 ,040R 0 ,040R:00s0S p 0S000 0S 0000S00 0 00  00  00 0  @000S 00   00   00   00  0 00   00 0 0S&0`0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 I000S000 0 00   00   00  00  㿵 00 0 0 00  ᴵ000S00 p  0W 0S 0P00 0 0 0St0SX|00H K圽 0S0t0S* L0X X x0R$ X x0 00 \0t P 0S\0 t0T \ t0P t0 0t  `  ` x0 x0   0St0SH0l0KH-(M  $0 0K B 0S 0$0 0 0 @  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  ۴ 00 0 000S00  000  000  000  00  㲴000S0 0  0 00  0 00  0 00  0 00 ㉴ 00 0 000S0K  0K0  0K0  0K0  0K  e0  00 0 0S 0 0 00 Ѷ 000S00  000  000  000  00  ( 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  س000S0 0  0 00  0 00  0 00  0 00 㯳 00 0 000S0K  0K0  0K0  0K0  0K  ㋳0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0  _000S0,0  0,00  0,00  0,00  0, 00 6 00 0 000S0K  0K0  0K0  0K0  0K  0 0 00 0 000S040  0400  0400  0400  040  000S080  0800  0800  0800  08 00 㽲 00 0 000S0<0  0<00  0<00  0<00  0<0  㔲 00 0  0 0KH-(M  $0 0K ္ 0S 0$0 0 0 D  00 V00  000S0  00  00  00  0  G 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 DZ 00 0 000S0K  0K0  0K0  0K0  0K  㣱0  00 0 0S 0 0 00  000S00  000  000  000  00  f 00 0 000S0K  0K0  0K0  0K0  0K  B0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  ɰ0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0  㝰000S0,0  0,00  0,00  0,00  0, 00 t 00 0 000S0K  0K0  0K0  0K0  0K  P0 0 00 0 000S040  0400  0400  0400  040  $000S080  0800  0800  0800  08 00 00 0 000S0<0  0<00  0<00  0<00  0<0  ү 00 0 000S0K  0K0  0K0  0K0  0K  㮯0 @ 00 0  0 0KH-xMp t x |0 0\0 \0\0 p000 x0X0 0d0 00 00 |00Sp029S t0S0$0 0 0 0 t0S0h0 T0KL0 0P0 P0T0 ;t0@0S d0t a 0S 0t0 00 00L0 t0000@0S 0 0t00,0 0 000 0 0S000 00S00S0X0 t0 0h0 p0P0 0sp= 0S 0D0D0 00S 000D 3/ D 00D0 0St0S D H0K  0S 0D0 \0K  0S 0\00H0 0S H D00c0 εH0 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000Sh0K0 0 00h K 00h K 00h K h0K  㝮 00 0 000SL00 0 00L  00L  00L  L0  y000S 00L   00L   00L   00L   0 L00 P 00 0 p0P0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  ( 00 0 000S00 0 00  00  00  0  00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  ޭ 00 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S p >0S000 0S 0I000S 00 0 00  00  00  0  ね000S 00   00   00   00  0 00 X  = 00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  - 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 危0S000 0S 0000S00 0 00  00  00 0  Ь000S 00   00   00   00  0 00 㧬  ㌳ 00 0 0`0 000S`0K0 0 00` K 00` K 00` K `0K  | 00 0 0S t0S2 00<0,0 0 ,000R 0 ,000R030#s00 ,040R 0 ,040R:00s0S p ܰ0S000 0S 0000S00 0 00  00  00 0  000S 00   00   00   00  0 00   ۲ 00 0 000S 00 0 00  00  00  0  ͫ 00 0 $0`0 000S`0K0 0 00` K 00` K 00` K `0K  㧫 00 0 0St0SX|00H K女 0S0t0S* L0X X x0R$ X x0 00 \0t P 0S\0 t0T \ t0P t0 0t  `  ` x0 x0   0St0SH0u0KH-(M  $0 0K K 0S 0$0 0 0 (  00 !00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  㻪000S0 0  0 00  0 00  0 00  0 00 㒪 00 0 000S0K  0K0  0K0  0K0  0K  n0  00 0 0S 0 0 00 ڬ 000S00  000  000  000  00  1000S00  000  000  000  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0  㸩 00 0 000S0K  0K0  0K0  0K0  0K  㔩0 $ 00 0  0 0KH-(M  $0 0K } 0S 0$0 0 0 ,  00 S00  000S0  00  00  00  0  D 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 Ĩ 00 0 000S0K  0K0  0K0  0K0  0K  㠨0  00 0 0S 0 0 00   000S00  000  000  000  00  c000S00  000  000  000  0 00 : 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0  00 0 000S0K  0K0  0K0  0K0  0K  Ƨ0 $ 00 0 000S0K  0K0  0K0  0K0  0K  㟧0 ( 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 0\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l R 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh. 0S 0j,0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0G<0 T0K  0S 0:T00@0 0S @ <00c0 忭@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  㲦 00 0 000S`0K0 0 00` K 00` K 00` K `0K  ㎦ 00 0 000SD00 0 00D  00D  00D  D0  j000S 00D   00D   00D   00D   0 D00 A 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h y0S000 0S 03000S00 0 00  00  00 0  㼥000S 00   00   00   00  0 00 㓥  x 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  h 00 0 000S 00 0 00  00  00  0  D 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0Ƭ0KH-(M  $0 0K ᜫ 0S 0$0 0 0 0  00 r00  000S0  00  00  00  0  c 00 0 000S00 0  00 00  00 00  00 00  00 0  5 00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  㿣0  00 0 0S 0 0 00 + 000S0K  0K0  0K0  0K0  0K  ㇣0  00 0 000S00  000  000  000  00  [ 00 0 000S00  000  000  000  00  2 00 0 000S0 0  0 00  0 00  0 00  0 0  00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 000S0K  0K0  0K0  0K0  0K  㾢0 ( 00 0 000S0,0  0,00  0,00  0,00  0,0  㒢 00 0  0 0KH-hM` d h l0 0P0 P0P0 `000 h0L0 !0X0 00 00 l00S`029S d0S00 0 0 0 d0S0\0 H0K@0 0D0 D0H0 ;d0@0S X0d H 0S 0d0 00 00@0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0L0 d0 0\0 `0P0 0s`$ 0S 0K0080 00S 0008 3/ 8 0080 0Sd0S 8 <0K  0S 0(80 P0K  0S 0P00<0 0S < 800c0 嵨<0 0 000SX0K0 0 00X K 00X K 00X K X0K  㨡 00 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  ㄡ 00 0 000S@00 0 00@  00@  00@  @0  `000S 00@   00@   00@   00@   0 @00 7 00 0 `0P0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  00 0 000S00 0 00  00  00 0  Š 00 0 000S 00 0 00  00  00  0  㡠 00 0 000S00 0 00  00  00 0  } 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  W 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  1 00 0 000S00 0 00  00  00 0  00 0 0Sd0SLl00< K  0S0d0S* @0L L h0R$ L h0 00 P0d P 0SP0 d0T P d0P d0 0d  `  ` h0 h0   0Sd0S<0ۧ0KH-(M  $0 0K ᱦ 0S 0$0 0 0 (  00 ㇦00  000S0  00  00  00  0  x 00 0 000S00 0  00 00  00 00  00 00  00 0  J 00 0 000S00  000  000  000  00  !000S0 0  0 00  0 00  0 00  0 00 00 0 000S0K  0K0  0K0  0K0  0K  Ԟ0  00 0 0S 0 0 00 @ 000S0K  0K0  0K0  0K0  0K  㜞0  00 0 000S0K  0K0  0K0  0K0  0K  u0  00 0 000S0K  0K0  0K0  0K0  0K  N0  00 0 000S0 0  0 00  0 00  0 00  0 0  " 00 0 000S0$0  0$00  0$00  0$00  0$0  00 0  0 0KH-hM` d h l0 0P0 P0P0 `000 h0L0 "0X0 00 00 l00S`029S d0S0]0 0 0 0 d0S0\0 H0K@0 0D0 D0H0 ;d0@0S X0d 寢 0S 0=d0 00 00@0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0L0 d0 0\0 `0P0 0s`勧 0S 0(080 00S 0008 3/ 8 0080 0Sd0S 8 <0K V 0S 080 P0K I 0S 0P00<0 0S < 800c0 <0 0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 000S@00 0 00@  00@  00@  @0  ǜ000S 00@   00@   00@   00@   0 @00 㞜 00 0 `0P0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  v 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  P 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K  * 00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 000S00 0 00  00  00 0  00 0 000S00 0 00  00  00 0  㼛 00 0 0Sd0SLl00< K庣 0S0d0S* @0L L h0R$ L h0 00 P0d P 0SP0 d0T P d0P d0 0d  `  ` h0 h0   0Sd0S<0ኣ0KH-MA@  10 0  0S 0h10 0 0S 0[x10 0 0S 0NH10 0 0S 0A10 0ե 0S 0400 0ȥ 0S 0'00 0㻥 0S 000 !0㮥 0S 0 X00 "0㡥 0S 00K$^<` H- M   0 00 00 0 00S 00S0  0 0  0 !0  r !0  0  0 003S000S000  000KH- M   0 000 003S00 0 00S00ؤ0 000KH-8M8 < 00 <0ᾠ<0H00 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 000 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 000 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 000 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 000 $0K  $0K0  $0K0  $0K0  $0K0 0 00$ K 00$ K 00$ K 000 (0K  (0K0  (0K0  (0K0  (0K0 0 00( K 00( K 00( K 000 0 0 1,0K  ,0K0  ,0K0  ,0K0  ,0K0 0 00, K 00, K 00, K 000 00 0 0S000 00K  00K0  00K0  00K0  00K0 0 000 K 000 K 000 K 000 0KH-|MJ@p t x |0 p000 000 0$0 0 p00$0 t0 t00 0S t00000 000 p 0S 0w$00 $0002<S 020s0S "00B0$0000(0 (00S 000 $01s00s0$00 02<S 020s0S 00>0$000$   ",R  " r R "  B $  0bs00Cs0 00,0 (00S= (00S# $0800#!,0R:$001 02<S 020s0S 00@0$0 c0R*pۛ 0S 0$000$00 t x00$000$   ",R  " r R "  B $  0bs00Cs0D0 p0d0p lHKd K7 0Sd0Kp . 0S 0h$00 $0002<S 020s0S "00B0$0000(0 (0 $0`0 $0` $0 $D0s $0$$040s $0$p0d0p ld Kt 0S 0&0X0 x00CS񏐏~}00S d0K h0Kxpt؞h0Stx党0$01s00s0$00 02<S 020s0S 00>0$000$   ",R  " r R "  B $  0bs00Cs $0$t00s $0$$0`0 $0` x0 S0T0 $0 $$04T0 T0s $0$$04T0 $04 $0400T0 D20Ý0$0p0 p00p  0Sd0Kp 1 0S 0kx0S6 x0#00@0S0S+ $0$$040s00s $0$t00s $0$$0$t00s00s00s $0$$0$t00s00s00s $0$t00s $0$00e0*`0p 0㦙 0!$0 $0002<S 020s0S "00B0$00000| 10KS bH-M 00 0 00$0 0$0(0 00,0 00S0 0x K 0S 0x0x   x0 x0  x0 !x0  r !x0  x0x   ,00,01 D0K - 0St0H0 ,00 ,00 02<S  020s0S "00B0,00000S Sq S!,01s 00s0,00 02<S  020s0S 00>0,000,   ",R  " r R "  B ,  0bs00Cs0\0 ,0 ,00 02<S  020s0S "00B0,00000`0 x \0s00s0?0`K 㔖 7,0 ,00 02<S  020s0S "00B0,0000t K -t0[0s0>0Kp0<0 l080 0\0 @0K`0 x \0`K [ 0S}D0SD 00S@ 000S; 081<S6000S 000H0S 000H0 20S#00S 000S 0 ,00x0,01h0K   0l 0S700 D 010 x00  0S &000 D0S D 0100S,00 ,00 02<S  020s0S "00B0,000000 ,01s 00s0,00 02<S  020s0S 00>0,000,   ",R  " r R "  B ,  0bs00Cs0 000 01K00Kz0K >7[\0 000 0`0 7[0 00 x [\0s00s0?0`Kg 0S D0SE 00SA 000S< 081<S7000S 000H0S 000H0 20S$00S 000S 0 ,00x0,01[h0K@@   0w 0S 700 D 010004![RD 010x0 0[  0SJ000 D0S D 0100S'[1[0s001K0[00K 00RZ: ,0 0$ 0S ,00 00(̘ 0S,00,010 x00 0 x 00(4 40S 0S400 0S ,0 $,0$,0$,0$,0$D0S D0$c0KH-(M  $0 00s01K00 0S 00s 1[0s01K1[00K0[   $0 0S 0@ 0 0 0 00 0 000 0K 000 00 0S 00 00 00 0 00 00 00 0K 0  0 0 0KH-M  000 0$00 00 0 00 0002<S 020s0S "00B0 0000$0 $00S $00S0 01s00 00 02<S 020s0S 00>0 000   ",R  " r R "  B   0b(0 ( 000C0 $00S 000 0800#!0R"*(0S(0 c 00102<S 020s0S 00@0 00cR0U 0800#!0R : (0 c 00102<S 020s0S 00@0 00cR0- 0800#!0R:0000 01S00 00 02<S 020s0S 00>0 000   ",R  " r R  @   0b 00 0p0 000t0 >p0S 0 p 00c 0S 00 00tKpKۑ 0S 0p01 02<S 020s0S 00@0p0 c0R*p00t0 t0S 00 00岖 0S 0p0S  00 p0K ㎚ 0S 0u0 00pK取 0S 0 p 000\p01 02<S 020s0S 00@0p0 c0R*p p0K N 0S 0 p 000.00S 000S 081<S000S 000H0S 000H0 20S 0 0 000 0L0 00 0002<S 020s0S 00@0 00000S$ 00 0 0 0002<S 020s0S 00@0 0000H0 0D0 00 ^ 0 0002<S 020s0S 00@0 00000H0 01S00s0 00 02<S 020s0S 00>0 000   ",R  " r R  @   0bs00Cs0D0 00 p H0K|KvK 0 0S 0R$00S" 00 0 0 0002<S 020s0S "00B0 0000d0 0`0 00 0002<S 020s0S "00B0 00000S 00 0 0 0002<S 020s0S "00B0 00000d0 01s00s0 00 02<S 020s0S 00>0 000   ",R  " r R "  B   0bs00Cs0`0 0 p07[p0l0K  HKdK 08 0S 0 p 0000l0 0h0 07K0 00pK嚔 0S 0 p 000gp0l K 00 01 p0vKՑ 0S* 00 01 p00[ 0Se 081 0S 0000s0S000S 080X  X 0  0 00宙, ,0S 0S,00 p  0 00 0 '[ 0! 0`0 0` 0`0 0` 0KH-M` d h l0 `000 0\0Kl0X0 0 0 `00S `000S `081<S`000S `000H0S `000H0 20Sm\0K80 040 d 02<S 020s0S 00@0h000d 0T0 h0S00d 02<S 020s0S 00>0h000d ",R  " r R  @ h  0bP0 `0 d0ddh TK8K 0H 0S 0d0 d0  h0S00d 02<S 020s0S 00>0h000d ",R  " r R  @ h  0b0C0 0SH d 02<S 020s0S 00@000 d d0100 0  h0000d010c ᣑd0!0s00s d0!h00K0[0 0 [   r  r 0[00Kd01 [R:d 02<S 020s0S 00@0h000d  \0K 㓍 0KH-HMDß @ D H L0 @000 @000 00S 00200 0`00s0S 0400K00 0002<S 020s0S "00B00000[000 0 01s00s000 02<S 020s0S 00>0000   ",R  " r R "  B   0bs00Cs 0$043K160K  00 0 040 3[00 4 K0D3/ L0 L00S L00S 00S 0 SL0 #[0[0s000K3[0 0 0 04 [R: [H0 0 [$#[0$0`0 0` K&lH- M  000 00 0 0 0ؕ 0S 0" 0000 0  0s 0!00S 0 0 0`00S 00 0 0`0 0` 0KH-PM0 4 8 <0 0000 000 000S 0000S 00000 0H0S 0H0\0S 7?O00 00000 0000S 0000L 0L0R 00 s0(0S 0(030S 7?O00 0 K 00R= 00S; 00 0 0`00S5 0 40R3 00S 000:S 00 0S 4t0S 01 80R 0<  0s 0!0S 0 0R 00  00 0 0S0(0S 0(0d0S 7?OU000 0S 0L 0L0R 0H0S 0H0I0S 7?O:0S6 000S2 0000S- 0081<S(0000S 0000H0S 0000H0 20S,0K 4  <  8     0$ $0S $00KH-(M 000 0$0 0 0(10 000 00 (   0㛍 0S 0 0 008 | 0S 0(0S 0 0(0x0KH-M 00$00 00 0 080S 0  08 00ɕ 0S 0 0 8 0(0S 0(0῍00KH- M  000 0(1 0 000 00 (   0- 0S 00$080 000KH-M@@ 0 0J? ὑ 0S 0'0(10 0  0  0 0  0h  !0\  "0P  "0D  "08  !0,  $"0KlH-M 0(1S0 0 0(1᎒0 (!0K-M  0(10 0 0 0Ћ/H-M00   ")R   d 0 㩐0㴌 0S 00(1 0 0  0K0bH-M00   ")R   d 0 ~0㉌ 0S 00(1 0 0  0K8DbH-M00   ")R   d 0 S0^ 0S 00(1 0 0  0KTbH-M  D 0S 00(1 0 0 0 0KH-M00   ")R   d 0 0 0S 00(1 0 0  0K|hbH-4MB@( , 0 40 (000 0$0 00s0S 000s0S 00$K0(,0  0a 0S 0$000 (0(10 0 $0 0Su080 a50@RI0 0S 0800S1010  0080X 0 080000s0S (02 (0"080000S (02,(0"080000S (02#(0"0800S%(026S (0$ 080 0600S 00L0@0S (026S004 0哓00 $0኎ 0S 0S 00 $0f 0S 0S 00 0KxbH-,MC@( , 0 (000 0000 (023S+ 0K K 0K0 K 0K0 K 0K0 K 0K K 0K0 K 0K0 K 0K0 K 00CS 0|" , 6?O(023S 0@" , 00ʒ 0S 0|(0 0S (0 0S 0r(0 (Ȋ 0S 0f0000!  0ߑ 0S 0W00000s0S (02 (0" (020S ,10, ǒ0>00000S (02#(0" (023S 00, 寒0&00000S (00S(0   (00S p00, 啒0 00 (0 (08 0040 0Kbbbb4clpcH-,MXC@( , 0 40 (000 (0(10 0 0S0# 00S 00S 00 C000 0 00S036 00 0 3 0 ,,㊎,04 ,00  , a50@ 0,0  (0 ,0 (020s0S ,000s ,0 (02<S 00, ,0 ,0 ,0!,0  ,0  ,00  0 C,0H 0 C,0L 00 C,0P 0 ,0T 0 ,0X 0 0(D!  3/ ,0\ ,04 (080 C(020S ,000 ,00 (023S ,000 ,00 (00S ,000 ,00 00 ,0` 00 ,0`,0  000  0R,0  000 0S 0KcH-MX \ ` d0 X00 0 X0$00 0D0 0H0 0P0 X02;S| 0L0 L0K D K \ `0 0S 0E040 000 D 40KX 0L0 D0L  D00D 4 KX`ޏ 0SD X00\i 0D0 0SL0K H K \ `0 0SH0L  H0 H0  H0 !H0X  r !H0  H0  H0 H0  H0 L0HX`囏 0SH X00\& 0H0 0S,0K OX00@0 X0 080 X0"28@0<0 @0K,0 0(0 X0X0 P0K 0S 0P0D0 040 000 D 40KX ]0L0 D0L  0D ,0KJ 0SyX0PX0 X029S 00d    0 ` 0㈆ 0SY0D0 P0H0 H0L  H0 H0  H0 !H0X  r !H0  H0  H0 H0  0LP ,0K 0S0X0LPX0 X029S 00d    0 ` 0; 0S0H0  P0S P0 ῍D0S D X00\OH0S H X00\F0KH-M` d h l0 `000 `0$00 00 0L0 0 0 000 0@0 000s0S 00K0`hl  0T 0S 0a d0T00K 0㟇 0Sd0T 00LKh 傅 0SL H0KLd0T H0KdW0T0 0X0  X0@K 0r 0S00X K Kh V 0SL0   ` 00 L0L `  000 0SL0  1SL0 d0T0L`l 0S00S5 00S 00H0S 00H0 20S%00S 00L0@0Sl0S 0 L `L H     `l 0X 0SQL 00hb 0SI0L0 0 T00T0 00T KPKh Մ 0S5 0T  P0T  P0 P0  P0 !P0d  r !P0  P0  P0 P 00h$ 0S  0S 00h 0S 0S0 0 @0S 0 @0Kኅ000 0S 0S0 0 L0S L 00h 0S 0S0 0 00S 0 00Kc000 0S 0S0 0 0S 0዇ 0S 0S0 0 0KH- M30       `  R   #0~0 0`0 0` ю 0S 0 0P0S( 0T0S$ 0P 00102<S 020s0S 00@0 00cR* 0 0T 0 % 0! 001RG* 00 0002<S 020s0S "00B0 00000S' 0 0002<S 020s0S "00B0 00000  Z 0`0 0` 0U 0`00S& 0J 0 0002<S 020s0S "00B0  000 04000 ' 0! 001R: 000S 0`0@ 0` 6?O 0000 0 !寋 0S4 0 0`0 0` 0KdcH- M 00 0 0$00 000 00 00S 0 0 00响 傃 0S 0S00 0KH-M 000 00S 00{00 0 0 @ 0 D 0  0 $ 0 $0 $0 $0 P 0 T 0 %0 ` 0 0 !0  0K0H- M  000 1 0S 0080H 0@ 0@@08P0@00001 0 0`0 0`  i0 K00H- M  000  0S 00`0 0` 0 @ 0@@08P0@00001 0  屋0 K0H- M  00 0 000 0`0 0`  0S 0 0`0 0S 0`00S 00 0002<S 020s0S "00B0 00000S' 0 0002<S 020s0S "00B0 00000  ā 0`0 0` 0 04S6 0J 0 0002<S 020s0S "00B0  000 0400C0 㒁 0$ 040cs00Cs 0$ 0u 0`00S 0`0 0` 0`0@ 0` 0d 0`0 0` 01S  00 0 0 0S 0`0@ 0` 6?OJ 0 0 0S 0? 00! 0! 0!?R* 00! 0! 0000 ۉ 0S 0" 00! 0! 0000 0S 01S 0`0@ 0` 6?O 010Cs 0! 墅0KH-M   000  0S 00`00S 0!?RI 0`00SD 00 00002<S 0020s0S "00B000000S"0$04R0`00S 0`0 0` 0`0@ 0` 00`0 0` 010s 0!*0`00S0`00S 0`0 0` 0`0@ 0` 00`00S 0`0 0S 0`0 0` 010s 0!0`0 0` {0!?R0 !0`0 0` m0`0 0S 010s 0!0`0 0` \0`00S; 04S7 04 040 04R:0`00S 0`0 0` 0`0@ 0` 0<0$040s00s 0$0$04R':0`0 0` 010s 0!0`00S 0`0 0` 0`0@ 0` 0010s 0!0`0 0`  凄0KH-HM8 < @ D0 8000 <011K< 02<S 020s0S 00@000 0SD00D0000 0S00000 0   00$0 @0S @0 ?R @002K40K0.0K08<D 0c~( (0S (0t@0S "[@0 1[S 2[![R2[0 0<  r  br 2[00 0< $ r  br < <010,0 2[S0 <010c0 < <02<S 020s0S 00>0[0000 ,00c0 $00c, 0, 2[00 2[0  [2[0c0 2[0 0  00 0   $ r  br 00 0 1[ 0Rʾ2[0 0< $ r  br r  r r  r 2[00 0< $ r  br r  r <0!$0s00cs <0!0S < 02<S 020s0S 00@0[000< D0 D00 ~;< <02<S 020s0S 00@0[0000 r < 02<S 020s0S 00@0[0000< D0 D00 ~ 0S < 02<S 020s0S "00B0[000< 0 00 j~;< <02<S 020s0S "00B0[0000 r < 02<S 020s0S "00B0[0000< 0 00 -~<010s <0!0KH-M   0 00S00  00 0000  00KH-hMP T X \0 P00 0 P000 P0 00 T010 0(10 0H0 00 T T 02<S  020s0S 00@00000 0 00S( S 00L K }X0 L0R 00D K }DL 00 0H0K 0  X0囀$ $0Sl $000S @0K や 00@0 X00<0 00@ K X3/0SUX00S 00s0T  02<S  020s0S 00>0000T ",R  " r R  @   0bs00Cs0QX0 0 X00 0H0 0 T00}0H0S 000  0RA0s 0 H0S  \0 0KH-Mh l p t0 h000 h000 h0 00 0(1 0 00K0`0 0 0 l010s00 c00s00s 0s000Kl 02<S 020s0S 00@0[0000l 0$0 l l02<S 020s0S 00@0[0000(0 (00Snl l02<S 020s0S 00@0[0000,0 ,00X K Gt0S0p000T K <,00P K 5T P0R0`0 L0K f 0H0 ,0L0 00L K 0`0K0 p0€0 00S 00,00P K PX  00 0`0K 0 p0E0 00S 000[S00s0l 02<S 020s0S 00>0[000l ",R  " r R  @ [  0bs00Cs0X0 t0S,$0L0 X0H0 p00,0 ,00P K 㯃,00\ K 㨃P\ 0 L0K ` K  ~0 00S 00``00c`0 5 00S L0K Ă$0L0 X0H0 00L Kp3/0`0 p0 p0X0Q01$ ᇃ0`0 `0Sp0 X0R:p0 X0R000`0 `0S0 [ 0 0`0Sڶ0[0 0 00C0 000 0S`0Sڶ0[00K0 [ 0 0KH-MJ@  0 011K00 0 0(1$0 $00S 0 02<S 020s0S 00@000000 00s 02<S 020s0S 00@0000cs00Cs00 01Ke 02<S 020s0S 00@0[00000(0 1[S00s0 02<S 020s0S 00>0[000 ",R  " r R  @ [  0bs00Cs0,0 02<S 020s0S 00<0[00000Sl 02<S 020s0S 00@0[00000SQP0K 㓁l0K ㎁ 0h0 h0L0 02<S 020s0S 00<0[000 0P0 02<S 020s0S 00@0[000 0l0 $0 P0KlK x K  ~0 00S! 00 02<S 020s0S 00<0[00000Sol0K &,0h0 02<S 020s0S 00@0[000 0l0 02<S 020s0S 00<0[0000 0t K z 02<S 020s0S 00<0[0000 0p K ypt$0 l0K x K  |0 00S 00 02<S 020s0S 00@0[00000SoP0K 㛀0L0 02<S 020s0S 00@0[000 0P0 02<S 020s0S 00@0[0000 0t K xy 02<S 020s0S 00@0[0000 0p K Zypt$0 P0K x K  @|0 00S 00z ,0R01( 0x0 x0S, 0R0x0 x0S, 0R*0x0 x0SN ,0R010 \10 (0勃1[ @!  ᄃ ,1001K 02<S 020s0S 00@0[0040 400    ^1[01K![1[R: 00R |0 00S 00 (00 ,00 1[01K![1[R:0Kcddd$dH-HM8 < 8000 800 0 800S8 8000S3 8081<S.8000S 8000H0S 8000H0 20S00(0 <0,0 80 <0<40K̠,K  0~ 0S 0040 000 <04 K 0 % 0 T 0<08< 品0KH-(M  000 0 0 0S 000 00 0K I 0S 0D 00  :x 0 0 0 0 0 0 0 !00s 0! 0  0  00K 0[ 0z 0S0[00K01 [R:0S0 0 0K0H- M  000 0$0 0 00$0 00 00 00 $012K$00S$0 0 00$ x 0S 0$00,0 , ,02<S 020s0S 00@0[00000S#, 02<S 020s0S 00@0[0000, 0 K w07 00 0SI, ,02<S 020s0S "00B0[00000S S& S$ ), 02<S 020s0S "00B0[0000, 0 K Fw0 $0`0 $0` 0S 000S 000S 081<S000S 000H0S 000H0 20S, 02<S 020s0S 00@0[000, 0p0 2[S00, 02<S 020s0S 00>0[000, ",R  " r R  @ [  0bl0 , 02<S 020s0S "00B0[000, 0T0 2[s00, 02<S 020s0S 00>0[000, ",R  " r R "  B [  0bP0 0 ,0[,x0K0 pKTK 0/u 0S 0G0x0 0t0 ,0x K2[, v$0`0 $0` $0`0 $0` 081 0S 0000s0S000S  x 0S 0$080X  BX 00s0S 0  0my 0S 000S ,01S,0 0S,00S0,0 0S,00 00K 3v 0S 000S 00 00K v 0S00SC 000S> 081<S9000S 000H0S 000H0 20S&0p0 00l0 0,0P,@0000S 00x KP@ 0p0K00{ 0S \0x0 0t0 ,0x K0x K00S 0x K0S 0,  0  00 & 0S 00 3,0000 , 0K 00, [u,00  ,0 K,0 0 ,00K 0% 0S$0 !,0 $0 $0\ 0 $0\ 0v 0S 00 ,0 0 00K  0S,00S ,00 00K Gu 0S00 00 00 0,   0S 0  00S; 000S6 081<S1000S 000H0S 000H0 20S0 ,0 @0,0,,0x0KPPP@  0  0S |0x0 0t0 0x K0S 0x K,0x K,00S 0 $0 0!$0!00 ,0 $0 $0 !00 $0  ,0040 ,4v 0  00 ,8 80S 0S800 0S 0  00 8 80S 0S800 0S 0>$0 $01K4+ 0S 0-$0\ 0 $0\ 0%0S 0  00 ~0S 0  00 ~0S 0  00 ~0 K0H-M  00(0 (00,0 0000 0 0 00 0h0 0d0 0 0 0R0 0 00c 0 00 0 000c 0 00 000 000(02<S (020s0S "00B00000040 400S0080 80S 400 K s?001s(00s0000 (02<S (020s0S 00>000000  ( ",R ( " r R "  B 0  0bs00Cs00 0 0 0 0R00<0 <0S. 0S 0 0 0 00c 0 0 0 0 0 0 c 0R 00 0 0 0 0 c 00c 0 00 000c 0 0 0S  00  00c@0 00800#!@0R%:0S 0001 (02<S (020s0S 00@000 c 0R:<0S80S 0S 00S(0$000S (0$00 (0$00 0R(q0-0K y0 0 0000HPK (t 0S 00000H0 0014K$[d0K(H| 0SJ00`00P0 00S0 0R P0S 000 00 400S 40000 0K }y00 0 0 0000KKK (t 0S0S  0 0K, { 0S 000  000 00 Gy0 00T0 0 00 000X0 X T0R!* 00 00R 00 000c0 0S X  00$0  00cX 0$0 0$X u 000 00 r0S  000   00c0 0K0 Vv 0Sh0K f{ 0S0K 0x 0S00` P0 00` h00 00 0Rh00!001R~ d0Sh 00 d 01000\0 00 \0 00!\0!\0`0 \0` 0 0 000 d 0100S 0SB 00S> 000S9 081<S4000S 000H0S 000H0 20S!00S 000S 0 00 [0010KH ( 0w 0Sh0 0t h0S h0t` `0S 0S`00 d0S d0,hy0S 0,ay0000 000(02<S (020s0S "00B0000000D0 00D 0D0 00SF 000SA 081<S<000S 000H0S 000H0 20S)D00 0 00 0 0000010000000K K( 0z 0S 000 00 000 K0000010 00 ({0KH-0M( , 0 40 (000 , (02<S (020s0S 00@000 0S  00 , ,010 0 40S 000 00 ,010c 0 400S0s0, (02<S (020s0S 00>00000,( ",R ( " r R  @ 0  0bs00Cs0QW:,, (02<S (020s0S 00@0000000S0s0, (02<S (020s0S 00>00 000,( ",R ( " r R  @ 0  0bs00Cs0000 00c 0 00 , ,(02<S (020s0S 00@0000040000 00c 0 0S 00c 00  000 0  s0S 0 0 v000K"0S 0[0 0 [   r  br 0[0 0 [   r  r 0[00K,01 [R:0S ,0!0s00cs ,0!,0!0s00s ,0!40S$, (02<S (020s0S 00@00000 4000,  0 00 No, (02<S (020s0S 00@00000,  0 00 -oKH-M  00$0 0@0 $00(0 $0$0,0 0000 00 00 00 00 00 008@00x00!000 0 K  0Cq 0S0 00KK,'o 0S00S 0 0S 0008@00Zx00!000 0 00KK,n 0Sz0  0 0  0 !0$  r !0  0  00<00  $00 n00S8 000S3 081<S.000S 000H0S 000H0 20S$00x0 0|0 0 000K|K $ 0t 0S 200 00 0 K0   0 0  0 !0$  r !0  0  00 00 `0K uN0 @0K$/pw 0S01K0 0 0[`KKK $+p 0S`0 \0 Dv 0R0K0 0K0 1[s$000 $02<S $020s0S 00>0[000 $ ",R $ " r R "  B [  b1[S$000 $02<S $020s0S 00>0[000 $ ",R $ " r R  @ [  0b0040 001 $02<S $020s0S 00@00 c40RS*00S; 000S6 081<S1000S 000H0S 000H0 20S$00x0 00|0 0 00000K|K $ 0s 0S 00 00 00 K00 0_v 0S0:K![00Ko 0S0 0R5 0 0 $0 0DK $Hu 0SD0000 00 00 *[00!00 $00 \ D04 05p 0SD0ap 0S@0Sq 00 00 @ 0100080 80 00R801![R 00 80 *[80!00 000 @ 0100S0SC 00S? 000S: 081<S5000S 000H0S 000H0 20S"00S 000S 0 000[:[0K@@ $ 0r 0S31[01K01![R7:000 0 0R 0n 0S 00 0S00 0 00KK,wl 0S0SD 00S8 000S3 081<S.000S 000H0S 000H0 20S$00x0 0|0 0 000K|K $ 0er 0S 00 00 0 K@0S @0(t0@0 0S0S 0(s0S 0 0R 0m 0S 00 00SX 000SS 081<SN000S 000H0S 000H0 20S;$00x0 0|0 0 000K|K $ 0q 0S]0 K0|0 0 000K|K $ 0q 0SC0 K 0 0  0 0  0  00, v 0  00,v< <0SZ 0SW<0 0 T 0S 0  00,u0S 0  0 0  0 !0$  r !0  0  0  00,u0S 0 0R 0  00,u0S 0Km00<0 <0S 0S<0 0 @0S @0(r 0KH-M  0 00,0 ,0$000 0040 0 0 40T0S 40T040 00 400S0 004K0j8 80S 80B0000 0000 0 40800#1R00<0 0 40800#1R00@0 <0S 00 @0S 00  00D0 )4001 ,02<S ,020s0S 00@040 cD0R*4000H0 Hr8 80S 804001S4000S4001 ,02<S ,020s0S 00@040 cD0R(*0 0 400 000^o8 80S 80400 400 0[000\ ",R  " r R  @ [  0b00 Q\ 02<S 020s0S 00@0[0000\ 040 1[S00s0\ 02<S 020s0S 00>0[000\ ",R  " r R  @ [  0bs00Cs000 0SM\ 02<S 020s0S 00@0[000\ 0P0 1[S00\ 02<S 020s0S 00>0[000\ ",R  " r R  @ [  0bL0 Q\ 02<S 020s0S 00@0[0000\ 0P0 1[S00s0\ 02<S 020s0S 00>0[000\ ",R  " r R  @ [  0bs00Cs0L0 40KP K     Xd i 0S 0 0KH-LM( , 0 40 (000 0$00 $0K(  wp 0S 0k(00SC (000S> (081<S9(000S (000H0S (000H0 20S&(0 ,0,$0$0 0K@@@  0p 0S (0 (00, q0#0 0 00 $0 K, $0 ,0 $0,  00S (0 (00, p $ 40 0K0H- 0M0 4 0000 0$00 0000 00 0,0 0081 0Sn00000Sh0000Sc 0D 0@0R 00S 000h000 0S 0y0  00S 0$0S 027S 40S0,K00  00S04k 0S 0Q0S04 $ 0@ 0D ,0S 0 ,0Kf000 0S 05,0S 0,0K0S)00S%0 0S0@@08P0@00o001 0 0 00 000e 0S 00 K0H-(M $ 000 0$0 0 000 00S 0 0 00  p 0S 00  0 00$KK e 0S 0  0 $ 0 0 !0K0H- M $ 000 080S000 0S c 0S 0'0@@08P0@00n00100 0S j 0S 000 0  $0?g 0$ $ 0 K0H-(M $ ( $  02<S  020s0S 00@00 0 (0S 00s0$  02<S  020s0S 00>0(000$ ",R  " r R  @ (  0bs(0s 00s0$  02<S  020s0S 00>0(000$ ",R  " r R "  B (  0bs000K(0s0 $010CR $ $0100 0[ 00 (000 00 $010c h$0!0[0s $0!$010Cs $0!(00K0[0 0 [   [ r 0[00K$01 [R:KH-\MF@@ D H L0 0SL0s001K@00$0 $00(0 @00S @000S @000,0 (0H0S (0H0(k0S 7?O$00 00000 0000S 0000L $0L0R 00 f$0(0S $0(0(k0S 7?Oc000 > @0R4 00S20000 00 H0R+00S 000:S 00 0S Hl0S001![R00`00S 00\ 0R:00\000 000 0S$0(0S $0(0( c0S 7?O000 0S 0L $0L0R $00 00000 0000S 0000L $0L0R 00 $0(0S $0(0(Dk0S 7?O000 j @0R` 00S^0000 00 D0RW00S 000:S 00 0S Dk0SB0S S S%00H  001![R$00\ 0 00\ 00H  00\ 0 00\ 00H  00![!00\ 0 00\ (20i0|,0S 0 ,0R 00 000 0S$0(0S $0(0(Vb0S 7?OX000 0S 0L $0L0Rc (0H0S (0H0(;b0S 7?O=0S6 @00S2 @000S- @081<S(@000S @000H0S @000H0 20S![<0KDH   $, 0h4 40S 400  0K(dH-XM@ D H L0 000 080 0,0 040 000 00 0S 000D 0 K,K@ 0e 0S  N7?OR00 0 40K a 0S404 8!,8!00$00 ,00 8 K  0Gb 0S3 L0S L0S  6?ORu 0 ,00 b x,0 0Si,0$0Se,00 8 K  0b 0S 0 ,00 b XH0 800R H0 800R*00H0 800R H0 800R*0000 80 ,0 0R 80 ,0 0R*0080 ,0$0R 80 ,0$0R*0000 L0S L0S-0S*800S800S 800S800S@00S @00H0S @00H0 20s0S 80 ,0 0@ h ,000 0 00S0SL0S L0S 0 Sm0SjL0S L0Sd00 80K    0}f 0S 0 800 b L0S L0S ,000s0S 00$0 ,000S 0 0 L0S L0S ,000S 0 0 0 0 ,00s03K48,0(0, D: K$ 4c 0Sl80L R L RH K,  F 00S0SL0S L0S 0 S70S4L0S L0S.00 80K    0f 0S 0 800 a /08 ,00 `80L R L RH ,  8 000@k 0S 080 , H0 00 80S 8 000$k,0S ,0@h40S 40c( (0S 0S(00 0KH-HM8 < @ D0 000 000 0$0 0,0 0(0 00 0S 000< ( K$K8 0j 0S  N7?OR00 (0$00 $0$0 0 K  0T` 0S  6?OR# ( $0$0 ` {0 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $0(0R 00 $0(0R*0000 $0,0R 00 $0,0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0(08 )g 0S D0S D0S$00@S 0S>D0S D0S8$00PS4(0 00K    0d 0S ( 000 4` 00$ $  00$  00$ 0  00 !00(  r !00  00  0 0 30S D0S D0S$00PS 0S#D0S D0S$00@S(0 00K    0ad 0S ( 000 _ 0 0 0S 00D R D R@ $ ( 0 (00i 0S]000 $00S% $00 0 K  0_ 0S  6?OR ( $00 _ ?@0 000R @0 000R*00@0 000R @0 000R*0000 00 $00R 00 $00R*0000 $0 0R 00 $0 0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $008 e 0 0 0S D0S D0S$00@S 0S(D0S D0S"$00PS(0 00K    0tc 0S ( 000 ^ 00$ $  0 0 70S D0S D0S$00PS 0S'D0S D0S!$00@S(0 00K    0;c 0S ( 000 ^ Z00$ 0  0 0 0S 00D R D R@ $  0 (00zh 0S5000 $000S% $000 0 K  0] 0S  6?OR ( $000 z^ @0 000R @0 000R*00@0 000R @0 000R*0000 00 $040R 00 $040R*0000 $080R 00 $080R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0408 d 0 0 0S D0S D0S$00@S 0S(D0S D0S"$00PS(0 00K    0Jb 0S ( 000 ] i00$ $ 0 0 70S D0S D0S$00PS 0S'D0S D0S!$00@S(0 00K    0b 0S ( 000 ] 000$  0 0 0S 00D R D R@ $ 4 0 (00Pg 0S 000 $ @0 00 00S 0 (004g$0S $08d,0S ,0_ 0S 0S 00 0KH-xM` d h l0 000 0X0 000 080 040 00 0S 000d 4 K0K` 0f 0S  N7?ORk00 _40$00 000 X K  0d\ 0S  6?ORH 4 000 \ Hh0 X00R h0 X00R*00h0 X00R h0 X00R*000 0 X0 000R X0 000R*00X0 00 0R X0 00 0R*000$0 l0S l0S-$0S*X00SX00S X00SX00S`00S `00H0S `00H0 20s0S X0 000` ;c T0K b00 00H 00,0R00H 00,00c 0 00 00, 00H00c 0 00 $0S*l0S l0S$00D0T0 00H0P0 40 X0K    0` 0S 4 X00 3\ X0h 00 2 0S/l0S l0S)00(0T0 00,0P0 0S000 40 X0K    0|` 0S 4 X00 \ XX00  00 0S9 4X00 00$0 TKne00`0S( X0 X0402<S 4020s0S 00@000000(0 l0S l0S(0 (0 X 400e 0S 0X0 0 h0 00 X0S X 400we00S 00`b80S 808^, ,0S 0S,00 0KH-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0yZ 0S N7?OR|0 0 n$ (0K ]Y 0Sm(0( 8!,8!$0$00 00 , K  0Z 0S3 <0S <0S  6?OR? $  00 [ B 080S3 0<0S/ 00 , K  0kZ 0S $  00 Z "80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 080R ,0 080R*00,0 0<0R ,0 0<0R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 0800 Ga 0S><0S <0S8$0 ,0K    0^ 0S $ ,00 cZ 00S , 0 0 0 yY 00 S ( ,0 b 0Sj,08 O0SL<0S <0SF$0 ,0K    0^ 0S $ ,00 !Z G 00S 00 S , 0 0 0 3Y,0   ,0 ,0  ,0 !,0$  r !,0  ,0  ,0 8 , $00c 0S 0,0 80 0 0 ,0S , $00c 0S 00a(0S (0j\ 0S 0S0 0 0KH-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0a 0S N7?OR0 0 $0$00 00 , K  0X 0S 6?OR $  00 eY 80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 00R ,0 00R*00,0 00R ,0 00R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 000 _ y0S2<0S <0S,$0 ,0K    0H] 0S $ ,00 X X, 08 0<0 W,0   ,0 ,08 >0S;<0S <0S5$0 ,0K    0] 0S $ ,00 X ",0   ,0 ,0   ,0 !,0$  r !,0  ,0  ,0  , $00Kb 0S0,0 0 0 , K  0W 0S 6?OR $  0 0 OX 80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 0$0R ,0 0$0R*00,0 0(0R ,0 0(0R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 0$00 ^ c0S"<0S <0S$0 ,0K    02\ 0S $ ,00 W B,08 )0S&<0S <0S $0 ,0K    0 \ 0S $ ,00 W , 08 0<0 V, $00Za 0S0,0 0,0S 0,0 , K  0V 0S 6?OR $  0,0 ZW 80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 000R ,0 000R*00,0 040R ,0 040R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 0000 ] n0S&<0S <0S $0 ,0K    0=[ 0S $ ,00 V M,0  ,08 )0S&<0S <0S $0 ,0K    0[ 0S $ ,00 V #,0  ,0 0 , $00a` 0S0,0 80 0 0 ,0S , $00C` 0S 00](0S (0Y 0S 0S0 0 0KH-\MP T X \0 00 0 0<0 00 040 0@0 080 00 0S 000T 8 K4KP 0U 0S  N7?OR00 8 @0K  'T 0S@0@ 8!,8!80$00 4000^0 3 4000R00$0 4000H0 40<0S 40 H00H0 0D0 H0K D K  0CU 0S \0S \0S H0K D K  0/U  6?OR 0S 0S~0H0 $00 X0 D00R X0 D00R*00X0 D00R X0 D00R*0000 D0 4040R D0 4040R*00D0 4080R D0 4080R*000(0 \0S \0S-(0S*D00SD00S D00SD00SP00S P00H0S P00H0 20s0S D0 4040P \ (0S"\0S \0S@0 D0K    0Y 0S 8 D00 "U D0X D0SA\0S \0S;40<0S D0S D0  0^ 0S0D0 4000  0Z 0S @0 D0K    0YY 0S 8 D00 T D04 4 D0S D @00 ^ 0S@00,0 @0uR 0SX0 ,0800R X0 ,0800R*00X0 ,0800R X0 ,0800R*0000 ,080 40(0R ,080 40(0R*00,080 40,0R ,080 40,0R*000(0 \0S \0S2(0S/,0800S,0800S ,0800S,0800SP00S P00H0S P00H0 20s0S ,080 40(0P Z (0S=\0S \0S7,080@     0X 0S 8 ,0800 T ,080H  H $0S ,080, 8 L P ,0804  , 8 P  L ,080X <0S9\0S \0S3,080@     0SX 0S 8 ,0800 S ,0804  H $0S ,0804  L ,080, 8 L P ,0804 ( 0S= \0S: \0S7 ,08@4000Y\0001S*,080@     0 X 0S 8 ,0800 S W,08@40002\004 04   b B0!0S.$0S+ \0S \0S%,080@     0W 0S 8 ,0800 US ,08@4000[000 !40 40$0R 400 < K  0R 0S \0S \0S 6?OR00 X0 <00R X0 <00R*00X0 <00R X0 <00R*0000 <0 400R <0 400R*00<0 40 0R <0 40 0R*000(0 (0S"\0S \0S@0 <0K    0=W 0S 8 <00 R <0X D0S>\0S \0S:@0 <0K    0W 0S 8 <00 R f<04  ,080<0 @0 <0K    0V 0S 8 <00 zR E0S \0S \0S<04 @ \0S \0S<0 H0R*<0H  40 40$0R < @00 (\ 0S0<0 4 X0 00 <0S < @00 \@0S @0V40S 40P]Y@0S @0T0 00S 0S000 0KH-HM8 < @ D0 000 0$0 0 0 0,0 0(0 00 0S 000< ( K K8 0?Q 0S N7?OR0 0 ( ,0K O 0S,0, 8!,8!(0$00 040 40K $ K  0Q 0S D0S D0Sc( 40 Q o@0 $00R @0 $00R*00@0 $00R @0 $00R*0000 $0 00R $0 00R*00$0 00R $0 00R*0000 D0S D0S-0S*$00S$00S $00S$00S800S 800H0S 800H0 20s0S $0 008 W 0 0 000C40 D0S D0S),  0@  0S0S(0 $0K    0zU 0S ( $00 P $0@ D0S D0S000 40K 0 K  0IP 0S00 @00R00 @00R 00 0Z 0S000  6?OR00S 00 0Z 0S| 00 0=V 0Ss0S(0 $0K    0U 0S ( $00 P Y$0 ( 040 0S(0 $0K    0T 0S ( $00 qP 8$0  $0 40R*(0 $0K    0T 0S ( $00 OP $04  0S @0 0 0 $0S $ (00Z 0S 08gW,0S ,0R 0S 0S0 0 0KH-0M $ ( 000 0$0 0 0 00 $0 $0 000C0 0K  K  0WO 0S01S00S00S   00 Y0Q0K  K  05O 0S 0 0 O0: 0 0K    0)T 0S 00 O 0  0 0  0 !0  r !0  0  0(   00 eY0KH-DMB@8 < @ D0 000 0,0 040 000 00 0S 000< 0 K,K8 0O 0S  N7?ORf00 ^0 40K aM 0SW404 8!,8!00$00 D0SF,0$0 0 00CS00 00 00 00 8410X00 ,400$0 ,0 $0 ,00s $0!,0 0s $0$,0, $0\ 0S$0`0 $0` 4,0 ,0(0 nQ, @0 ,0S ,08+V40S 40Q( (0S 0S(00 0K(+8dH-PM@ D H L0 000 000 080 040 00 0S 000D 4 K0K@ 0{X 0S  N7?OR00 40$00 L0S00 00 00$0 0 @0H0S @0H0@U0S 7?O400 00000 0000Sl 0000L 40L0R b40(0S 40(0@U0S 7?O00 0 : 00$0 0000CS.}@?}$0 000R" 00S 000:S 00 0S $0 0 U0S $01 0R $0`00S $0\ 0R:00 $0 $01 0R$0\ 0 c$0\ $0 000R$01 0R$0`00S $0\ 0R: 00S 000:S 00 0S $0 0 U0S00 $0 $0\ 0 c$0\ $0 !$0`00S$0 000R$01 00$0R 00S 000:S 00 0S $0 0 PU0S00 0s $0!00 $0 |$00Sw $000(0 (0 000Rn(01 00$0Rg$000S $0000:S $000 0S $0 (0 0U0SK(000s0S $0`0 $0` 40(0S 40(0@L0S 7?O$00O 0S`40(0S 40(0@uT0S 7?Oi$0   00 0 0S40(0S 40(0@K0S 7?O9000 0S 0L 40L0R @0H0S @0H0@K0S 7?O0 H0 00S 00@*T80S 80O, ,0S 0S,00 0KH-\MP T X \0 000 0@0 00 080 0D0 0<0 00 0S 000T < K8KP 0/K 0S  N7?ORg00 Q< D0K J 0SXD0D 8!,8!<0$00 80009U0 3 8000R00 0 8000L0 80<0S 80 L00L0 0$0 0H0 $00$0 L0K$  H K  0K 0S 0S0L0 00 X0 H00R X0 H00R*00X0 H00R X0 H00R*000(0 H0 8040R H0 8040R*00H0 8080R H0 8080R*000,0 \0S \0S-,0S*H00SH00S H00SH00SP00S P00H0S P00H0 20s0S H0 8040P R ,0S"\0S \0SD0 H0K    0;P 0S < H00 K ~H0X %(0S"\0S \0SD0 H0K    0P 0S < H00 K XH08 4 H0S H D00dU 0S=D0000 D03I 0S5X0 00800R X0 00800R*00X0 00800R X0 00800R*000(0 0080 80(0R 0080 80(0R*000080 80,0R 0080 80,0R*000,0 \0S \0S2,0S/00800S00800S 00800S00800SP00S P00H0S P00H0 20s0S 0080 80(0P Q ,0S=\0S \0S70080D     0RO 0S < 00800 J 0080H  H 0S 00800 8 L P 00808  0 8 P  L 0080X <(0S9\0S \0S30080D     0O 0S < 00800 J S00808  H 0S 00808  L 00800 8 L P 00808 ( 0S7 008@8000S0001S*0080D     0N 0S < 00800 PJ 008@8000R008 08   b B0!80 80$0R 800 @ K  0I 0S \0S \0S 6?OR00 X0 @00R X0 @00R*00X0 @00R X0 @00R*000(0 @0 800R @0 800R*00@0 80 0R @0 80 0R*000,0 ,0S"\0S \0SD0 @0K    03N 0S < @00 I v@0X D(0S>\0S \0S:D0 @0K    0 N 0S < @00 I P@08  0080@0 D0 @0K    0M 0S < @00 pI /@0 L0R*@0L  80 80$0R @ D002S 0S0@0 8 X0 00 @0S @ D00SD0S D0M80S 80PiPD0S D0K4 40S 0S400 0KH-DM0E@8 < @ D0 000 0(0 0$0 000 0,0 00 0S 000< , K$K8 0uO 0S  N7?OR00 , 00K F 0S000 8!,8!,0$00 040 40K ( K  0&H 0S D0S D0S, 40 H (0 $00R (0 $00R*00(0 $00R (0 $00R*0000 D0S D0S-0S*(00S(00S (00S(00S800S 800H0S 800H0 20s0S (0 $008 O r$0 $0 000C40 D0S D0S)0 $0@  0SZ0S,00 (0K    0L 0S , (00 *H @(0@ D0S D0S 8\10Q8M +(0 40R*00 (0K    0tL 0S , (00 G (04  0S$ @0 00 (0S ( 000Q$0S $08O00S 00zJ 0S 0S 00 0Kd`dH-0M $ ( 00$00 0 0 0 $0 $0 000C0 0K  K  0G 0S01S00S00S$   00 iQ 0S 0B0@0K  K  0F 0S 0 0 qG0)0  0 0  0 !0  r !0  0  0(   00 'Q 0S 00KH-,MpA@ $ ( 0K $( GE 0S 0H000 0D 0S*0H 0S$0 8! 8!0 00 0;E 0S0I 0S0K 0S 0080S 0K0I0K lH-$M@@ $ D 0S 000 0K `  D K 0S 0S00 $0S  $0 0K H-0[0000| ",R  " r R "  B [  0bs00C1K| |02<S 020s0S "00B0[00000 00K 00 0 0[0 0r K B'[0[0s000K [1[R: 0 |00cB0d0[00K [1[R\: 0 |010s0 0 Qp0KT Hp0Kx| 0qE 0S 0A 0<0 0< 0@ ($0,00 0@ 0 `0 0 * 0,0 0, 00 002<S 020s0S 00@0c|010c 00 0 |00B00KH-MA@ 000 000 0@0l!  `10K0D0D!  <10K04!  10K04   00K04   00K0P0   00K0T0|   00K0\0T   d00K0`0 L    800EK,g4gHgXgpgggggg0H- PMD@H L P T0 H000 080 0$0 0 H00$0 00 00 0S 00J( (0S$080(  1S $080H 0R:$0 @ $08P00xJ00!00,0 $0,  HLK $000S $000,0 00 s$00 $0002<S 020s0S 00@0000000 0000CSAIH,000< K @< 80KH I 0S 08 <0T P0? 0Sr80D 0S 0~080 000< K z@<0HP T02I 0S Y0010pG P000 $001 0R$00 @0KPHT 00 00S00 K $, wD 0S 0R 0 0 0K D>0[00K01 [R: 0K-,M $ ( ,0 00 0 0 00 00 00 0  0 0Ћ/H-0M $ ( ,0 0 0 00 00 0K  < 0S 00 0 %G 0xA 0S 0S00 0K0H- @MD@8 < @ D0 800 0 00 40K<D P@ 0S 0&80(1$0 $0S $0 0S $0 00 l400 40<0@0S@0 8< D0= 0S  7?OR00 00S@0\P08#  3/0U 0@0S 30D )H00 @0H <0 0R0@0S@0H0 d# D H00 @0H0S @0H00F0 30(0 @0L (00CR 0@0S @0L0(  B " D G00 (00(0 @0P (00CR 0@0S @0P0(  B h" D G00 40@ T , @0X0S0@0S@0X0 " D G00 40 0 40@ X 0 @0000s0S 404 <  < @0000S 404 <  < 00 " 030C,0 ,00~F @0 !,0 <0 0R 0@0S 10D 0}G00 000 @0  1S 0S40 < <0 00S 0S000 0@0S <D(D0 00S 0S000 0S0S 07?O K0hhh$iXiiiH-DM4C@8 < @ D0 800$0 00 00K<D ? 0S 0@00 S @00S $20}C 008<@ D0? 0S 7?OR{00 @ 802<S 8020s0S 00@00(0 00 8000 ( @00c0 @00( 00 0R :0@0S$10D 0F00 H 0R :0@0S$p10D F00 700( 000 000 00008<D @0D 0S 000 @01 0R00S@00 S<008 @0B 0S 00 00$< ;, ,0S 0S,0 0 0S0S 07?OKii jH-lMXG@` d h l0 T0Kdh 3> 0S 0l l`02<S `020s0S 00@0000000CS{ 00S0@0S `0 T00`&  0F0S`00s0l `02<S `020s0S 00>0000l` ",R ` " r R  @   0bs00C1Kl l`02<S `020s0S 00@0000000 00KI0[ 0V K !; [5[0 1[R0@0S `0 T00$  0E7?O0  [5[00 0X K :%[5[R 0@0S `0 T00$  0E7?O0 %[0[0s000K [1[R:T0T <  < 00S1[` H0S T0T <  < l `02<S `020s0S 00@0000l 04 K :0 d0 0R0 T00R 00S0@0S `0 T000"  0'E7?O0 P0K jA00P0 0L0 ,0D0 T0 P0Kd 8< 0Spl `02<S `020s0S 00@0000l 0( K R:$ d0 0R$ T00R $0S0@0S `0 T00T!  0D7?O0 3P0K A$0P0 0L0 T0 P0Kd ; 0ST0T <  < 0@0S `0 T00   0D7?O0 `0 T0d 9 0S 0S 00 0KLj|jjj k0000 ",R  " r R  @   0b1K 02<S 020s0S 00@00000 0 1[S ![00R 1[ 0 00c 00R7?O0  000CS񏐯X0S00s0 02<S 020s0S 00>0000 ",R  " r R  @   0bs00C1K 0 1[ 41[@0 0D0 D0K   L60 0? 0S^ 00 d1[ S7?O0 ] 00 K 4 D0KK (3 0S 00 |0K   50 0e?8D0K   H50 0V? 0S 00 #1[S7?O0  00 K R40 0R:00S|0K   40 0*? 0S 00  0D0K> 0S 00 0S00s0 02<S 020s0S 00>0000 ",R  " r R  @   0bs00C1K00S00 00s0S 1[S7?O0 `0K :0@ 0K : 0S 0 @0 30`0 @0\0  0S 00 1[0 0$0 0K$ 3$00$0 8[ 1[0 1[R ![1[0cs00Cs08K7?O0 8[$ w38[@0 0D0 D0K   @10 0T> 0S 00 ([1[0s001K1[ 1[R:0 0j; 00S 7?O0 000 0 0K;:( (0S (00S0S 00K\mmH-@M0 4 8 <0 00 4000 00$00 0 0 00 u00< 80 !00$0 $0K K  0+3 0S 0^ 00 S 00S' 00 0 40 0 R 000=7?OE40 $0 : 0S 000r=02 00$0 0$0 000d= 0S 0 40 $0R:$0S 40$ (0Kn= 0S 0 (0S 000 80H 0R*0KH-\M A@X \ ` 00K a9L0K \9X00S X00000 00K%0[\ 0N K ]20[0\ 0L0 4[H0 00S 0KL K0X3/0S0L000 H0,0 $[0[0s000K [`0R:0K茺lH-4M( , 0 40 (000 (000 0,1@,00 C0,10800$0 $0   ( 00Z4 0S 00  0 $ 004( 09 0S& 400S  6?OR 0S00 00S (0 00#3000 0S 0S00 0X$ 0 ,00s 0,10s0$,aqs00cs00Cs 0!000S400S0 0200$  00  00@02<S 020s0S 000@0,1 0 0 000 !00 0 00 0 0KH-Mş p t x |0 p00 0 00$0 0,1(0 00 00 0 (0 0R 0 (0 0$ 10Jt@ 02<S  020s0S 000@ 0,1 0 0 000x 00,0 ,000 00 00 0S 0 0 0 (0 0R (0 0$T$ L$ ;0 0 0 0R 0 0 0$ J900 (0 0Rl p00S p000S p081<Sp000S p000H0S p000H0 20S ,000S>h0K0  7(0 0$ 7 0S 000 (0 0 0000 ,000s0S (0 00 0(0 (0 00 7000 000 0 000 000 00 00 p00SL p000SG p081<SBp000S p000H0S p000H0 20S/0H0 ,000S ,00L0 (0 0H0 p0t0 t0t0,00H0S L0K0x| 0 0J1 0S ,p081<St0 t0  ,000s ,0 0 00 000 0S00 (0 (0 000c 60S 00$80K8mmH-xMXȟ P T X \0 P000 00 0 0$0$0 0S 0 P00(0 \00CS+)('&%$! (0(0T  0S 0(0(0(   P 01 0S 470 900(0 0,10d0 d0 \ K p 0, 0S+0( `0H0R` `0H0p  \0S p0 \0K+000 0S 0S 00 p0 ` p005 0S 0S00 00S 0 00pp 0G2 0S 0S00 0  00S p0 00y+000 0S 0S00 0L0K0K0H- MO@  0 0080 800<0 80$0@0 00D0 00 00 081;S 000 00 00 0 00 000 00,0 ,0H0 H040 0S0,0 00 0S000 00 00 00 802:S 00S 00L0 0$0 0 0 00 80,1P0 P000 00 0 00KK@)( (0S (000S 0#02@0S 0 K  0+( (0S0$0 D00S D00@,00(0 (0S00CS񏐊|z\ |{zyji6?O(0 D0(0S D0(0 D0( D0(0SD0(0 D0( D0( 0L0Rb:0H 0L0RD0( 0H0RX*D0( 0L0 c0HD0(00cRN*00 ,0S6?O(0 k00 0S040 <000s0S> 0  00@3( 00 (0S30 00< M*( (0S$0 00KK@')( (0S0 00< -*( (0SX $0S10 K  0+( (0S0$0 D0(0S D0( 0L0R=:0H 0L0RD0( 0H0R1*D0( 0L0 c0HD0(00cR%*0  00@L3( 00 (0S0 K  0*( (0S ( 6?OR6?O(0 0 00KK@(( (0S000K0 0*( (0S ( 6?OR6?O(0 0$0 00 0 0 0H00 D0 ( sD0(0S6 D0( 0H0R D0( 0H0R*0H 0L0RD0( 0L0RD0( 0L0 c0HD0(00cR6?O(0 fD0(0 CD0( D0(0S9D0(0 CD0( 80H 0L0R6?O(0 M0L0 CD0( D0(0S"D0(0 CD0( D0(08 ( (0S 3<60 &( + $0S 0S 0 0K)00(0 (0S0$0 D0( 00S L0S40S0000K00)( ( 6?OR ( 6?OR00S 00 0 K  0)( (0S0$0 (0S0S 0#<<@0SL0S D0( 0R 00S 0S 0 K  0)( (0S|0$0 0S D0( 0H0R 0SD0( 0L00CR 0S 0 0K(00(0 (0S| 0S 00 0Sf0Sc D0( 0H0R;*0H 0L0RD0( 0L0R/D0( 0L0 c0HD0(00cR#0S 0 S0S 0 0KH(00(0 (0S>0$0 D00K00 e6?O(0 D0( 0L0R:0H 0L0RD0( 0H0R*D0( 0L0 c0HD0(00cR*6?O(0 0S 0 0K(00(0 (0S0$0 D0(0 K  0W*( (0S 0S 0 0K'D000 D0K0D00KD0 $ 00 0S0S D0 0    0y.00 D0  0S 0 0K'00(0 (0S:00S D00S 0 D00'00(0 (0S 9D00S D00)00(0 (0S0S 0#92@0S98S;8@0S^m00S0 0 D0( 0H0R*0H 0L0RD0( 0L0RwD0( 0L0 c0HD0(00cRm00S 081=Sf 00 dD0( 0L0R#:0H 0L0RD0( 0H0R*D0( 0L0 c0HD0(00cR *00S 081=S 00 :00 7D0( 0H0R#*0H 0L0RD0( 0L0RD0( 0L0 c0HD0(00cR 00S 081=S 00 00 6?O(0 040 P802<S 8020s0S 000@80,1 0 0 000D !00T0 0S 0 ST00t0 P0 0p0 t0K8 _+( (0S 0 S 6?O(0 =0S 000S80 D0(0$$ 0(( (0S00 0 0S# 0810S000S80T0 P0 0(((( (0S00 0 00S D0 D00 0,( (0SD000 800S X0K >%( (0SX0#( (0S X0](X0Y(( (0S00S_ 000SZ 081<SU000S 000H0S 000H0 20SBP00S P0 0S0 0DD( 8 0+( (0Su(T00t0 P0 0p0 0 0DD( tK8 0,( (0S Y0 0  T000s T0 0S 0 0K%00(0 (0S6$0S 0 K  0&( (0S'0$0 0SD0(00 0H 0R0 ( (0S D00S[ D0 D00 0,H H0S (0SH0(0 0S 0 0K9%00H0 H0S (0SH0(0 D0  +0S' 0 0K%  0S' 0  00@_.H H0S (0SH0(0 $0S 0S 0 0K$00H0 H0S (0SH0(0 ( 6?OR<001:S (06?O K0H-hMX \ ` X000 0$00 X000 00 0 00 011K0(0$0 0PK00( `0Rj `0 @ K X 0%  6?OR  6?OR00 0S0 00XX 0*+ 0S0  `0KT K X 0& 0ST0S @0S X0 @0KT$@0S X0 @0KJ$000 0S00S X0 008$000 0S\0L0(0 0 0 ` (0R0 0 \0\0\ X ,0 00Se ,0Sb `0,r0S00T0 T0S ` \0X0r0S `0sJT0S0 0   X 0$ 0S0 00X 0* 0S0  T0S0 0$ 00S X0 00#0000 00S 0S000 0S 00S 0 00XX 0Y* 0S0  `00`0 `0S0 0 `00`0 0S` (0Rv*`0 @ K X 0$  6?OR  6?OR00 c0S]`0KT K X 0% 0S @0SP X0 @0KY#J@0S X0 @0KO#000 0S00S X0 00=#000 0ST0S 0 00XX 0)0 00S 0S000 0  0  0![!0$ ( 0P0K0S\\0H `0RW X0 X00X\K& 0SFX00S. X000S) X081<S$X000S X000H0S X000H0 20SX0 \0( 0s# 0S \0 \0  \0` H 0KH-M  00,0 ,0$000 0040 081;S 0080 ,00<0 ,0,1 0@0 ,0,10D0 ,0,100 0<S00H0 0$0 0 l K  0d# 0S 00 00KK0F! 0S l0S 0 l0KD"000L0 L00 00 00(0 (00C(0 L 000P0 P00CP0 P0 0 40|K040  40(0S40(0 40( 40(0 K 8 0r$ 0S400T0 4010K0 0 00 T0S 40(0 | K  80" 0S~T,02<S ,020s0S 000@,0,1 0 0 000 [00X0 X000s0S 00 H0S 00( 0c(0 (0S 0SX 00 < ,02<S ,020s0S 000@00c$0 ( $0R P0R $ <000 0 6?O0 0[S 0[0C0K40(0 C40( 0(0 ,02<S ,020s0S 000@0T  $0  0 0 ( $00c(0 $0 00 H0S 40( 0 00C 0 X T0 c,02<S ,020s0S 000@0 cL00c00 0 00C 0 0@  00C 0 0SH0S  0 00C 0 0 00C 0 40(0 40( 0[00K [D0R!*40(0S 40( 0L0R:0H 0L0R40( 0H0R*40( 0L0 c0H40(00cR*400S 0 400 00\0 \0S 0S\00 400S 40 400 0~'\ \0S 0S\00 40  0S((0S%ڶ [D0R*40(0S40( 0L0R:0H 0L0R40( 0H0Rw*40( 0L0 c0H40(00cRk*40(0S (0S [D0R40(0 C40( H0S 0  0 0  000)\ \0S 0S\00 l0S 0 l0KX 00\0 \0S 0S\00 40|0K0KH- M  00 0 0 000 00S 00!000 0  0  0 0 !0 $ 0 ( 0 , 0K-M  000 00 0 0( 0( 0Ћ/H-MA@ 000 000 0S0 0K0 2" 0S 0W0 0 0T! ! 0! 0 08! ! 0! 0 0! ! 0! 0 0! ! 0 ! 0 0  ! 0! 0 0  ! 0! 0 0  ! 0! 0 0  ! 0  ! 0x  $! 0l  (! 0`  ,! 0T  0! 0 4!0KDk(D_gOH-M 0 00>&0KH-M00    R   l 0(0     R  ( 0(00KhmnH-\M@ D @000 00 000 80K0@ 0 0S  6?OR 00,1080 80 0 K @ 0  0S 00$00 @0 @008K4K 0S 00S @0 00K040L0S0,10S 0,1@40L0 C0,10l00 0S 0u@00S6 @000S1 @081<S,@000S @000H0S @000H0 20S@0 404H4L4  0$ 40 40  0S4 40LL0H0@0 4 @00' 0S 0S 00 00S @0 00Kf00 0 0S 0S 00 D0S D0  0KH-M  00 0 0 0(0  0S 0KH-(M  $0 0K # 0S 0=$0 0 0   00 #00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  x 00 0 000S00  000  000  000  00  O000S0 0  0 00  0 00  0 00  0 00 & 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00 n 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0  0 0KH-hM` d h l0 0P0 P0P0 `000 h0L0 T0X0 00 00 l00S`029S d0S00 0 0 0 d0S0\0 H0K@0 0D0 D0H0 ;d0@0S X0d V  0S 0d0 00 00@0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0L0 d0 0\0 `0P0 0s`2% 0S 0080 00S 0008 3/ 8 0080 0Sd0S 8 <0K ! 0S 0r80 P0K ! 0S 0eP00<0 0S < 800c0 !<0 0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S@00 0 00@  00@  00@  @0  n000S 00@   00@   00@   00@   0 @00 E 00 0 `0P0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0T0 000ST0K0 0 00T K 00T K 00T K T0K   00 0 0Sd0SLl00< K! 0S0d0S* @0L L h0R$ L h0 00 P0d P 0SP0 d0T P d0P d0 0d  `  ` h0 h0   0Sd0S<0!0KH-(M  $0 0K u  0S 0-$0 0 0 4  00 K 00  000S0  00  00  00  0  < 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00  00 0 000S00  000  000  000  00   00 0 000S0K  0K0  0K0  0K0  0K  o0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  70  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0  000S0,0  0,00  0,00  0,00  0, 00 m 00 0 000S0K  0K0  0K0  0K0  0K  I0 0 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 U0\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l  0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh  0S 040<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0<0 T0K  0S 0T00@0 0S @ <00c0 i@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  \ 00 0 000S`0K0 0 00` K 00` K 00` K `0K  8 00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00  00 0 000S00 0 00  00  00  0  00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  y 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  S 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  - 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h g0S000 0S 0000S00 0 00  00  00 0  000S 00   00   00   00  0 00   f 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  V 00 0 0Sl0SPt00@ KT 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0$0KH-(M  $0 0K  0S 0$0 0 0 (  00 00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  j000S0 0  0 00  0 00  0 00  0 00 A 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00  000S00  000  000  000  00  000S00  000  000  000  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0  g 00 0 000S0K  0K0  0K0  0K0  0K  C0 $ 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 O0\0 00 00 t00Sh029S l0S00 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l  0S 0~l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh 0S 0D(0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0!<0 T0K  0S 0T00@0 0S @ <00c0 c@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  V 00 0 000S`0K0 0 00` K 00` K 00` K `0K  2 00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0 000S00 0 00  00  00 0  `000S 00   00   00   00  0 00 7   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 000S 00 0 00  00  00  0   00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@00KH-(M  $0 0K f 0S 0O$0 0 0 d  00 <00  000S0  00  00  00  0  - 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00  000S00  000  000  000  00  L000S00  000  000  000  0 00 # 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0  00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 0(0 000S0,0  0,00  0,00  0,00  0,0  } 00 0 0 ( 0,0 0 0 000S0D0  0D00  0D00  0D00  0D0  L 00 0 0H0 -000S0L0  0L00  0L00  0L00  0L0   00 0 0 H 0L0 0 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 P0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l  0S 0ql0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0sh 0S 070S 004 4 0S 0000<0 00S 000< 3/ < 00<0 0Sl0S < @0K c 0S 0<0 T0K V 0S 0T00@0 0S @ <00c0 )@0 0 000S`0K0 0 00` K 00` K 00` K `0K   00 0 000Sd0K0 0 00d K 00d K 00d K d0K  00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h 0S000 0S 0000S00 0 00  00  00 0  & 000S 00   00   00   00  0 00    00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 000S 00 0 00  00  00  0  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  _ 00 0 5000S000 0 00   00   00  00  5 00 0 0 00  * 00 0 0 000S00 0 00  00  00 0   00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  00 0 5000S000 0 00   00   00  00  00 0 0 00  00 0 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0r0KH-(M  $0 0K H 0S 0$0 0 0 D  00 00  000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00  00 0 000S0K  0K0  0K0  0K0  0K  k0  00 0 0S 0 0 00   000S00  000  000  000  00  .000S00  000  000  000  0 00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0 0  0 00  0 00  0 00  0 0   00 0 000S0K  0K0  0K0  0K0  0K  0 $ 00 0 0(0 o000S0,0  0,00  0,00  0,00  0,0  _ 00 0 0 ( 0,0 0 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 S0`0 00 00 t00Sh029S l0S00 0 0 0 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l   0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0d0 h0P0 0sh 0S 00S 00,0,0<0 00S 000< 3/ < 00<0 0Sl0S < @0K  0S 0<0 T0K  0S 0tT00@0 0S @ <00c0 s @0 0 000S`0K0 0 00` K 00` K 00` K `0K  f 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  B 00 0 000SD00 0 00D  00D  00D  D0  000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h - 0S000 0S 0m000S00 0 00  00  00 0  p000S 00   00   00   00  0 00 G  , 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S 00 0 00  00  00  0   00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K   00 0 5000S000 0 00   00   00  00   00 0 0 00  t00 0 0 0Sl0SPt00@ Kp  0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0@ 0KH-MA@  10 T0 0S 0400 U0 0S 0'00 O0 0S 0x00 P0 0S 0 H00 S0 0S 00K H-0M0 4 00 4" 40H0 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 0K  0K0  0K0  0K0  0K0 0 00 K 00 K 00 K 00 0 $0K  $0K0  $0K0  $0K0  $0K0 0 00$ K 00$ K 00$ K 00 0 0[? 0 (0K  (0K0  (0K0  (0K0  (0K0 0 00( K 00( K 00( K 00 0 0KH-(M $ ( ,0 00 ,00 0 003S0(00 00 S(0 D00K  0K0  0K0  0K0  0 K 00 K 00 K 00 K 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 0KH-GM M N@h l p$ t4 h4040 40080 40,1<0 000 <00S340$00 t4S,#h4 h40FK Ap0Sh4 0p$08 0Jh4 h40p0=p4  0800 40(0S 40(08j 0S 7?O'l4 C40,10qP0@0 <000 00S0 0@  0$0 $0 0 00 0,0 ]0 @0R0,0 0 @00c 0 0,0 00@ 0c 0 <0(0S0 <0, @0R <0,0@  c 0R0#03s0<0, @0 c 0R0#03s0S <0(00 0 @0R0,0 0 @00c 0 0,0 00@ 0c 0 ,0S 0 0RT00$0 0 000c00 ,0S 0 00R0 010 01 0 01 0 0 (,0SF0 0RAt4S t4S;0 00S60 000 0S u0 00S0 0 0 002C1 d00 0 00 0 00C 0 0 010  0 010 <00<  O0D0 D0 0R<0(00 0$0 0 0@  0 0 00 w0 00Sg00 ,0 0100S*0 01000 0S `0K.`00S 0 010  0 00SG000 0 0R0S* 0 0 01 000c1 0 000c1 01 0 0 0 0 0 0 0 0 0 00!0 00!0 08 ! 0 00S,0S)0 010 01 0 01 0  001 0 000c1 0 0 0 $01 0$00c1 0 @0R0@  0 @0R*0@  0 0100S050 <0h/0<0dE>K 0C0C@ 00 010080 00S0 01000 O<08040$ E>K 0C0Cd4\400@\0K4@ G\0K0(0 00s0S (00(0 4027S (00(0 80010S (00(0 <0l40 E>K 0C0C  (0J0 00S 0 010  "0 01000 t4S0 010  00s0S  40(0S 40(08k0S 7?O00Sl40Cl4 l$<00N0l4 t4S3)h4 h40FK Ap0 00S0mh4 400p$Q 0 h4 h404p0Up4  0P40(0S 40(080S 7?O@00@ 0c 0 0 010  B 0S t4S 00S0Q00S 0 010   H H0S 00SH000 40(0S 40(080S 7?O00Kd0nH-(M( , 0 0 (000 (0,10 (0(0S (0(0!0S 7?OJ,0 C(0,10(M00 000 0 0R0 0R*0(00 00 0c0 0 0100S0 0100 0 0 010   (0(0S (0(0j0S 7?O 0KH-(M( , (0,10 (000 0 0 (0(0S (0(00S 7?O,0 C(0,10L00 000 0 0R0 0R*0(00 00 0c0 0 0100 0 0SX 00S  0SO  j0 0100SE0 010  2 0S90S%0 0 0 0000c1 0 0000c10  0 00R 00 0 0 0R 00 C0 (0(0S (0(00S 7?O 0KH-M 0$0? 0S 00,10S 00   000K0H- PMH L P H00$0 H0$0(0 H0,1,0 P0 ,00S0,0d0S00@0 @0K < K (L 0 0S 0<0L000 <0H00 < H00(Ld 0S 0,00,  40 0 0R :0 00c4K000 0 0004K000 0S0$ P0 0S 0P000 80K HL _ 0S 0o0 0R:000 00 04K0 0c0 04K0 00 0@0 ?8@H0,1P@0 CH0,10^K0 0H 06 0S 0S.H0,1@@0 CH0,10>K00 CH0,105K0 0 000 @ 400@0 @ 0R:@ 0R0 0R*00 80 0 K00H- EMMC@@ D H$ H4 0<0 @4S @40S @4000S @4010S@0@480S080 80K@ $ $0S $040K@ j 0S 04 80  D4 0S|40,1(0 (00Sw 48 <0K ' 0Sn<0Sm 00 <00 000 000 00S(0h00P(0d0000 ,0 400,H$h 0SFH400 001 0 0 <00 *X10 (0h0/(dCK AC>K 0CX, 0  000 C>K 0C  ,00 0 0 000 00S0 <0S 40 <0-40 0 00S 0S000 0 K0T0nH-M   080 00 0 000 00C0 0S0K 0 00 0 0 000 00 0 00C0 0SKH-"M MPG@x | ( 8 x80$0 x8,1(0 0,0 ,00 0`0 0h8 h8d8 d8p8 0l8 (00S060 (0h/0(0dE>K 0C0C 0E>K 0C0C .K B B $ 0 0S 0h80 00S00 a00010K00 h(>K 0C`K$  0SE001 [ `0SA 00000 0.8 80S00 ;80080 80 0`< h8\@ @00D0 >K 0C0C$D : 0S00 00 8S >K 0C0C$ V 0S p80 p8 0S 0 000 p80 |400 00 l(01000< 0Sl(010 <00 0 0 000000S 00 0 00S 00Sl(0100 <00 6H \0KxH 8S, S:Sj dH30 h8l<D;x8d8x(" \ K , ,0Sw 0Sv,00 v20 /0>K 0C0CH0`20 (0h/0(0dE>K 0C0CH 0x829S E.K B B>K 0C0C\K $| 0S4 E10 (0h/0(0dE>K 0C0CH 0x829S  \KE>K 0C0C $|  0S000 `0 Rh8S h8$(d8S d8$!p8S p8$l8S l(`0$ )0K0n@nDnH-M@@ 0 0Kp v 0S 0 0,!04  !0(  @"0  0K0.H-(M( , 00 (0,10 0S0i000 0 0 0 0S/ 000  000 0  0S ,0@0S00j 0S 0S 00 000 00 0 0 0R*(0 0 00(0S 0(00 0 ,0@0S ( 0B 0S 0S 00 0`0S (0 0`0q(00l(0 ,!0K- M  0,1 0 0Ћ/H-M00   ")R   h 0 0 R  8 000,1  0KdLn`nH-DM8 < @ D0 80$00 800S 8000S 800000S 800010S800&0~80080S0,0 80 ,0K  0S 0i040 ,04 K0K 0 0S 0V80,1@00H0 C80,10F000 80,1@00L0S 00L00C08 ,! F00 0 00L 00H0R00$0 <0S <0  @0S @0  D0S D0$  0S 008 \ ,0 800'( (0S 0S(00 0KH-DM@ D 0K8 K<0KD@ 0S 0<0S0S 0@00S @000S @00000S @00010S@00k0@0080S0(0 @0 (0K  0S 0( $0K@  0S 00040 0 80R @0,1@@0,10F000 800 @0,100 N$4 ,0K 0 0S% 0S  6?ORF0 80RD00 F0S  6?OR;400CF0  c4000C40 00 ,0@D $4 ,0@ 0 0S40040 4 0R0 80R040 800 8000 $0 0S 0S 00 0KH-M   0 0000  00KH-M   0 0000  00KH-HMŸ ( , 0 40 (00 0 00 40S 00S 200 0S 00S 0000S 0010S ^0 080S0 0 0K   0S 0n(029S (00 #0K   0S 0[0( X X   0 , 00[ 0S0,10 00S 0, 0 (029S.0 X ,0S 0h0 , 0,0S0, S 0S 0S00 0 ,  0S 0S00 0Kn-M   00 000S 00*0 00 0 Ћ/H-M  0?  0KH-LMC@@ D H L0 @000 @0$00 @0,10 00 080 L0S 00S $300@0$00T0S 200@0" p"@0" t" 00s0S 000s0S 00$K0@DH  0 0S 0$ 04K 0\ 0SH0080K00D H0A 0S<80 S20@R 10L 00 080\ 0 00S @LZ 0S 0S>00 l 80T0 0 80P 0 80X 0  0 0 0 80S 8 $00Dk 0S 0S 00 40S $0 40K00 0 0S 0S 00 $0 0S 0S 00 0K8nn$oH-M0A@  0,10 0 0T 0"28@0 X00 0\ 0T 08 0 < 0 0`0  0S 00` 0h 0`0 0d 0d0S0` 0d 08  h 0d0  0d 0KHoH-,MXB@( , 0 (000 00 0000 (023S+ 0K K 0K0 K 0K0 K 0K0 K 0K K 0K0 K 0K0 K 0K0 K 00CS 08! , {6?OC(023S 0  , k0400 0S 0*(0 0S (0 0S 0 (0 ($ 0S 000 (0 (08 0040 (00  t"(0$  p"0K4LooH-MDB@  000 0,10 ,g0 0  0  0  S20@ 00  0 0 020s0S 000s 0 02<S 00, 0 0 0!0  00 0T 0 0P 0 02<S 020s0S 000@0 c0,1 000AB0 0X 0 L 0 H 0 0\ 0X 0 04 080 0,10S 0 00 00K贾oH-pMH L P T0 H02;S9 H0$0 0 0D0 D0K @ K L P0 0S 0}@0HB 0S @0 D0@HP 0S@ H00 Lp 0S] 0SZ00 WH000 H0 @0K= 0S 0I@0H 0S9H00<0 H0"28@080 040 <0K00 0,0 0@ 00K 0S!H0@H0 H029S 00T    0P 0 @0t0KH-hMX \ ` d0 0H0 H0H0 000 0<0 0$0 0,0 0(0 00 0S 000\ ( K$KX 0R 0S N7?OR 0 0 ( ,0K  0S,0, 8!,8!(0$00 (0,10L0 , L0<K 0H 0SL0K H K  0- 0S7 d0S d0SL0K H K  0 0S <0S ,0 <0KH0L  H0  $ `0 <0S ,0 <0K00 0 d0S d0S~$0 H0H0R3*H0H H0L0R$0 H0L0R'$0 H0L0 cH0H$000cR,0 H0K    0 0S ( H00 S tH0$  H  D0K D0S@0S H0 D0R H0 D0R030#s0 H0 @0R H0 @0R:00s0S ,0 H0K    0 0S ( H00  0H0D KH0 `00R H0 `00R0#03s0H0 `00R H0 `00R*00s0S ,0 H0K    0M 0S ( H00  H0` H0\0S00 H0\0H X 0 ,000 H0H0SjH0H  H f, H0H0PK 0x 0S00S ,0 00, 0 0SP0Sk 00S 0S H0H0?0S ( 0 0& 0S,0 H0K    0 0S ( H00 [ |H0H  H H0H0SH0H  H H0H H0L0R' $00 H0H0R*H0H H0L0R$00 H0L0R~$0 H0L00c H0H$0000RpH ,00 <0S ,0 <0K|000 0S 0S0 0 0S $ `0 0 0 H ,00<0S ,0 <0KO$0S $0X,0S ,0x 0S 0S 0 0 0KH-hMX \ ` d0 00 0 0$0 0,0 0(0 00 0S 000\ ( K$KX 0 0S  N7?OR00 ( ,0K   0S ,0, 8!,8!(0$00 (0,10L0 , L0DK 0 0SL0K H K  0 0S7 d0S d0SL0K H K  0 0S D0S ,0 D0KH0L  H0  $ `0 D0S ,0 D0K000 `0 H00R `0 H00R*00`0 H00R `0 H00R*0000 H0 $0(0R H0 $0(0R*00H0 $0,0R H0 $0,0R*0000 d0S d0Sr$000S' 0S$,0 H0K    0: 0S ( H00  @H0$  H H0$  L H0$ (  40K 40S00S 4 H00R 4 H00R0#03s0 0 H00R 0 H00R*00s0S ,0 H0K    0 0S ( H00 q H0$ ( d0S 0S,0 H0K    0 0S ( H00 M ,000 $000s0S< H0H $00R6$0 $00RH0$  H +, H0H0PK 0 0SP0SH0$  H 00S ,0 00, 0/ 0So$000S< H0L $0 0R6$0 $0$0R*H0$ $ L +, H0L0PK 0 0SMP0SH0$ $ L 00S ,0 00, 0 0S1H0` H ,00  0S2D0S ,0 D0K000 0S$$ `0 00 H ,00 eD0S ,0 D0K$0S $0X,0S ,0 0S 0S 00 0KH-`MP T X \0 0D0 D0D0 00 0 0$0 0,0 0(0 00 0S 000T ( K$KP 0 0S  N7?OR00 ( ,0K  : 0S,0, 8!,8!(0$00 ,$0 D0K 03 0SD00S",$0 ,0D0K 0 0S ,0 $00  D0$   D0  X0 D00R X0 D00R*00X0 D00R X0 D00R*0000 \0S \0S(0,10H0 , H0<K 0 0SUH0K @ K  0 0S <0SF ,0 <0KB@0H0S/ $0$ @0H0RM*@0H @0L0R$0$ @0L0RA$0$ @0L0 c@0H$0$00cR5@0H @0L0R @0H $0$0 c$0$@0L00cR#*,0 @0K    0 0S ( @00 E @0$ $ H @ ,00  @ ,00   <0S ,0 <0K000 0S 0S00 0S,D0 ,0D0K 00 0S ,0 D00  D0(02<S (020s0S 000@(0,1 0 0 000$  000 000s 0 0Sc\0S_D0$  Z\0S 0ST\0S \0SN,D0 ,0D0K 0 0S ,0 D00  cD0(02<S (020s0S 000@(0,1 0 0 000$  000 000s 0 \0SD0X ,$0 D0, 0 0S$ X0 00 ,$0 D0, 0d$0S $0Pt,0S ,0 0S 0S 00 0KH-`MP T X \0 0D0 D0D0 00 0 0$0 0,0 0(0 00 0S 000T ( K$KP 0= 0S  N7?OR00 ( ,0K   0S,0, 8!,8!(0$00 ,$0 \0S \0S 00D0K 0 0S \0S \0S 6?OR 0S| D00S",$0 ,0D0K 0 0S ,0 $00  |D0$   D0  X0 D00R X0 D00R*00X0 D00R X0 D00R*0000 \0S \0S(0,10H0 , H0<K 0 0S!H0K @ K  0 0S <0S ,0 <0K@0H0S/ $0$ @0H0R5*@0H @0L0R$0$ @0L0R)$0$ @0L0 c@0H$0$00cR@0H @0L0R @0H $0$0 c$0$@0L00cR *@0$ $ H @ ,00  @ ,00  <0S ,0 <0KU000 0S 0S00 0S,D0 ,0D0K 0 0S ,0 D00  ,D$0 $0$0$( 0S0Sc\0S_D0$  Z\0S 0ST\0S \0SN,D0 ,0D0K 0 0S ,0 D00 { eD0(02<S (020s0S 000@(0,1 0 0 000$  000 000s 0 \0SD0X ,$0 D0, 0^ 0S$ X0 00 ,$0 D0, 0=$0S $0PM,0S ,0 0S 0S 00 0KH-HM8 < @ D0 000 0000 00 0 0 0 0(0 0$0 00 0S 000< $ K K8 0w 0S  N7?ORF00 "$ (0K   0S7(0( 8!,8!$0$00 ( 0 D0S D0S 0000K 0 0S D0S D0S  6?OR 0S 000S"( 0 (000K 0 0S (0 00 k 00   00  @0 000R @0 000R*00@0 000R @0 000R*0000 D0S D0S$0,1040 40K , K  0 0S 0$ ,0H0R3*,0H ,0L0R 0$ ,0L0R' 0$ ,0L0 c,0H 0$00cR(0 ,0K    0p 0S $ ,00  o,0 $ H 0$ ,0L0R 0$ ,0L0R4:,0H ,0L0R 0$ ,0H0R(* 0$ ,0L0 c,0H 0$00cR*(0 ,0K    00 0S $ ,00  /,0 $  L , (00  0S D0S 0S(00 (000K 0 0S (0 000  (0 0 0$0 ( 0SD0S00@ D0S D0S 0L0SY (00 (000K 0y 0S (0 000 G (0 0 0$0 H 0S 0D00Sm00$02<S $020s0S 000@$0,1 0 0 000  000 000s 0 B(00 (000K 0 0S (0 000  h00$02<S $020s0S 000@$0,1 0 0 000  000 0 0S D0S00  ( 0 00( 0 0S @0 00 ( 0 00( 0 0S 08(0S (0 0S 0S00 0KH-tMh l p h00$0 0P0 $0$0(0 0T0 $0,1,0 l0S0J$0 T0K4 0S T04 O$0,1 000 ,00 P K h 0 0S,h0 h00\K( 0Sp0ST0\ ( T0\ ,  $0,1@\0H0 C$0,10G5000 $0,1@\0L0 C$0,10850040 h0 \ h00( P0S h0 P0KR0080 80S 0S80 0 0S0`0  40R $0,1@$0,105000 400 $0,10<0 `0 P K h 0! 0Sx` X0Kh 0 0S` <000C`0 6?OR<0S ` 0R  40RU0 0 `00C<40<  c`000C`0 0SDT0   X0 $0000c0@0 01KX0$02<S $020s0S 000@$0,1 0 0 000![000 6000s0S T0   T0T (0  ( 1[01KX0$02<S $020s0S 000@$0,1 0 0 000![000  @0R` X0hh 0! P0S h0 P0K`0080 80S 0S80 0 0S`00`0 ` 0R P0S h0 P0KA00 0 0S 40R0`0 400 400 ,0 $027S 00PKh 0S,h0 h0$027S 000\0K0( 0 0Sk$027S\ \0T,,0(0T0T  T0\  T0\   T0\ 0  T0\   T0\ \  T0\ P T0\ T $ T0\ H , T0\ L 0 h0 \ h00(3 P0S h0 P0K0080 80S 0S80 0 0Sl0T   T0S $0 T0P0S h0 P0K0080 80S 0S80 0 0KK- MC@0 4 000 0 00$0 400, K0 ( (0S (0400S 200$"  q$x20l,00$`"  d,00$D"  \,0 0$("  P,0$0$ "  L,00$!  @,00$!  8,0 0$!  0,00$!  (,0(P,00S0 ,0(03 0 1Y8$4 0`p,003,003 0 4 04 0Y3 0h500  $   C,0,0$   ,000$h   ,0$0Kdoopp4pPplppppqpq4qH- M  00 0 0 00 00 0L 0\ 0H 0X 0D 0T 0@ 0P 0< 0L 08 0H 04 0$0 0 00 0 , 0 ( 0 0 $ 0  0K-$M  00 0 0 00 00 0L 0H 0P 0L 0T 0P 0X 0T 0\ 0X 0 \ 0L0 0L 0H0S0 H 0  0Ћ/0H- XMG@P T X \0 0D0 D0D0 P00(0 P0,1,0 0@0 00 00 00 0H0 0L0 <0KT\ ,$ $0S $0<0<0@0S 0@0S(70\ 9X0P00 0X0X0 0 " 0PQ PqQ 0@P00 0QQPP0@0SX0P0( & \ Z7?O$0 9X0T T08 X0T0 ,0 X0P T0< T0< ,0 X0X T0@ T0@ ,0 X0\ T0D T0D ,0 T0X00S 00 0@0S(L50\ T0X0 T0X X0\ ,0 X0 P0 ,0\  \0 ,0 X0H T0H X0L T0L ,00S- P0,1PT0H0 CP0,10100 CP0,10 100 P0,1PT0L0 CP0,10000 CP0,10000 ,0h0 H K ( 0B$ $0SH L0KDK( j$ $0SH0(0H0 ,0d00 000 H0K(0 $ $0SH830 ,0d00$000 0 0 00 ZL 010 H00 50SJL 0100 000 4 ,00S  0R 4 0R:4 0R00s0 4 0R*4 0R00s0S@0S D 00c!@0K( N$ $0S)@  0104  00 0 000 D0 R 0S(t10 T0 P @ T0T <0(T 8 80S $0S80$0 L0S L D0( :H0S H0($0S @0S @0(0@0S T\\8 80S $0S80$0 $0S0S $07?O K0{Xqqq rr0H- 2M   # $3 ?Kx1 320 3<03 00 P S0<S 00s0S 000@@@x1 0 0 000 000 #30 0R0@0S3000$#0)7?O 000S 0@0S 30  T00$#07?O000 3@ 0R0 K0s@rtrH-$M`B@ $ ( 00 0K$  0S 000 S (0@0S 0010 00 ]$0 $00  0SN00 E(0@0S $L 0 0$  0S0K$  0S 0E0<00S00 S (0@0S  0 00   00 $0 $00 > 0S 000 $0 0R* 0 0$  0S 00S7?O0Krrr0H- XMG@H L P T0 0<0 <0<0 H00$0 H0,1(0 0@0 (00,0 000 00 0 00 0<0 ,0S0H0,1PL0H0 CH0,10.000 H0,1PL0L0 CH0,10.0040 0D0  40R H0,1PH0,10.000 400 L0P00 L0 80KH L 0S 0]0@0S D0L0S8D <0K 0@0 00S# 00S 0 6?OR D00C,t.0,  cD000CD0 0@0S 0S00 0 0<0 00 0 0@0S D <0PTHL0 00Sl 0S00 0 00 d< D0HL% 7?OR00  0SHLD @0KL \ 0S@0<00S3@00 S 0@0SD @00$Pf00 L0L0 D0  0Sv<0 D0HLV 7?OR00  0Sd@0$L s 0S0@0 8D <0H 00 00S 0@0S 0S 00 0 00 0 fD00D0 D 0R 40R0D0 400 400 0@0SI 0SF 00C0 L0T 0100L D 0D0 L0D D000 <0S 8D <0H 0/0 00S 0S00 0 @0S @0$L 0 00S 0S00 0 80S 800 00S 0S00 0 0S 0S 07?O K0orH-MdC@p t x |0 H0K d0K 00 00 p0$00\0 0 p0,1 0$0 $0D0 h0Kd0 0`0 x00Cp ,! 0h0 00 |  $00c0(0 |p02<S p020s0S 000@p0,1 0 0 000 000 k000S9000S6 00S000S/ 00H0 d0K   t  10 0f 0S 00 H0K  t  D10 0R 0S 00 h00h0 000 |p02<S p020s0S 000@p0,1 0 0 000 000  (0R:tx, ,0S ,00S0S 00KLhsH-(M $ ( ,0 $00 ,0R 0(00 (0 0 000S $00 0 00 0 $00 0 00 0 $00 0 00 0 $0 0 00 0 $0( (00(0 (00 000S# $000 0 000 $000 0 000 $000 0 000 $00 0 000 $00( (00(0 (00 000S# $000 0 000 $000 0 000 $000 0 000 $00 0 000 $00( o(00(0 (00 000S# $000 0 000 $000 0 000 $000 0 000 $00 0 000 $00( ;(00(0 $00S $0 $00( ,$00( 0(0 ( 00c 0 0KH-,MC@( , 0 40 00 4 0R:,00 (000S 000  00000 000  00000 000  00000 00 0 00000 ,00 00000 ,000 (000S 000  00000 000  00000 000  00000 00 0 00000 ,000 00000 ,000 (000S 000  00000 000  00000 000  00000 00 0 00000 ,000 00000 ,00 0 (000S 000  00000 000  00000 000  00000 00 0 00000 ,000 O00000 ,00  ,00 00 4 0R:,000 000 0S 00  0(000K`sH-8M0 4 8 <0 <0#S 0800 80 0 0000S 400 0 00 0 400 0 00 0 400 0 00 0 40 0 00 0 408 80080 800 0000S# 4000 0 000 4000 0 000 4000 0 000 400 0 000 4008 80080 800 0000S# 4000 0 000 4000 0 000 4000 0 000 400 0 000 4008 80080 800 0000S# 40 00 0 000 40 00 0 000 40 00 0 000 40 0 0 000 40 08 O80080 800 0000S# 4000 0 000 4000 0 000 4000 0 000 400 0 000 4008 80080 80 0 0000S# 4000 0 00 0 4000 0 00 0 4000 0 00 0 400 0 00 0 4008 80080 80$0 0000S# 4000 $0 $00$0 4000 $0 $00$0 4000 $0 $00$0 400 $0 $00$0 4008 80080 80(0 0000S# 4000 (0 (00(0 4000 (0 (00(0 4000 (0 (00(0 400 (0 (00(0 4008 80080 80,0 0000S# 40 00 ,0 ,00,0 40 00 ,0 ,00,0 40 00 ,0 ,00,0 40 0 ,0 ,00,0 40 08 K80080 8 00c 0 0KH-8M@ǟ 0 4 8 <0 <0#S400 0000S 008  80080 008  80080 008  80080 80 0 80080 408 80080 400 0 0000S 008  80080 008  80080 008  80080 80 0 80080 4008 80080 4000 0000S 008  80080 008  80080 008  80080 80 0 80080 4008 80080 40 00 0000S 008  80080 008  80080 008  80080 80 0 80080 40 08 s80080 4000 0000S 008  80080 008  80080 008  80080 80 0 80080 4008 B80080 4000 0000S 008  80080 008  80080 008  80080 80 0 80080 4008 80080 400 0 0000S 008  80080 008  80080 008  80080 80 0 80080 4008 80080 400$0 0000S $008  80080 $008  80080 $008  80080 80 $0 80080 4008 80080 40 0(0 0000S (008  80080 (008  80080 (008  80080 80 (0 80080 40 08 ~80080 0S 08  0000 0KtUl000 T K`  0S 0,00S 00`0S 7?O`00H00S `00H00`0S 7?O `00| 00S T0 T0 0`:T0 00R `00| 00S T0 00`%U7?O0 `  0S `00| 00S 0`T#  40K P0K T000X0 X0K40 000 00,0 <0 0 40KPKd a  6?OR`00| 00S T0 T0 0`t01 0!00 d0S``00| 00S T00`"  T0`d k 0S 0 40K 㣾?01 0!00 0 l0 00R l0 00R030#s0l0 00R l0 00R:00s0S 0l 0 T l00 0`dh 0 `00H00S `00H00`$0S 7?O00S 00`0S 7?OT0`0Kxx$y@yXyyH-4MC@( , 0 40 00 (000 0H00 0 28S04000  K(嫿 0S 000S 00(:0S 7?O(00H00S (00H00('0S 7?O 0 00R (00| 00Sd 0 00((\000 00S 00 C0 C(00| 00S 0 00( 0 00R00 C0 0 00R: 00 0 0 0 (00| 00S 0 00( 0000(,0 0 (00H00S (00H00(40S 7?O00S 00(%0S 7?O 0(0K$yyyH-MC@  " 2 00 200 20S400;S20| 00S 080d#  !080"    ˺ 0S22 00;S00 0S20S20S 22 ?K 0 2 20K"0L 0S200S 200S 200S@200S; 20| 00S 20!  ?K).22 202 202 200 ?Kᠼ 0SH20 00 0 28 20K 0n 0S528 20 ᰺20S20S 22 2 0 2"200C 0K`,zXzH-MF@p t x |0 p000 0<00 00 0(0 t000 0 x0 0R U7?O0 Xx0 t00R*p00| 00SB x0 t00tpX?p00| 00S x0 00tttpx0 t00Rt00S x0 t00R*x0 t0 t00 t0 00p St0 t00R0t 0X t0 `0K D0K p0S p00S p0000S p0010Sp0p080S0d0 d0Kp 0S 0t0d (0K 㭸 0St000h0 h0K`0 0\0 \0X0 @00 @0 `p10 0 0S0L<08 KXK`^ 0S%LX 80  ` 0SD0` ߱  0S 0`00S `*<0S <0`#D0`0K萼w8}uH-0M $ ( ,0 0 00 00 00 K(0S0K K $ 0 0SK0S00S90SC0K K $ 0 0S90S00S%0S1 0  0S)0 0K $ζ 0S 0R000 0S ,0  0 000S 00 ᙹ0 0KH-0M $ ( ,0 0K K $  0S 0900 ) 0100(, 0S 0100  K  0㼸 0S0  0 T000 0 R 0  ] 0KH-0 L0徺L P0R*4h>0P L0峺000 @0D000 @0 2@0S@0H0S 00 @0H000 @0<0T0 400|0>S T004=0L P0强T0S00$0 40S 400S 40000S 40010S404080S0p0 p0K4 㛶X X0S X00|0 x0K| K 4LP   0S  T7?OR00 x0SH0 0ST00,0 @0B?4 400H00S 400H004ᔷ0S 7?Oc400Sv 400H0Sq 400H020Sj 4ִ00 0Sc @0 2 @0 "400H00S 400H0040S 7?O40000004 0㺱 Kt0K4 0  400H00S 400H004=0S 7?O @0 2 @0 " X7?OR R R7?ORX400H00Sp 400H004᭮0Sh 7?O4@ 㱷 0S>00 000 400H00S 400H004፮0S 7?O0K4ᆳ400<00S 400<004ܶ0S 7?OH l0K0 400<00S 400<004W0S 7?O400H00S 400H004ᱶ0S 7?O@0 2.@0 "@0 2%@0 "400S 400H0S 400H020S 40S 00 @0 2y:S 400|0>S 470@0,0 0$0 @0$004 0S@0 @00@$@4@0S 00 @0 @0(l0K,$ 4@400|0>S 4600 0 @0$0(0 @0 @040R:@00S 00\0 400H00S 400H004ᱭ0S 7?O l0K, (    $  4L P0ܵ\0S 400H00S 400H0040S 7?O Kt0K4 0   X7?OR7 R R7?OR t0s @0 200S400|0>S 450Ꮈ 00R000 0!< S @0$ 004q400H00S 400H004᜵0S 7?Ok@0$ (0R! 400H00S 400H0040S 7?OS400|0>S @0$04# ( 7@0 @080R0:@00 0 @0 @00R@0 @0A?@(4@w400|0>S @014#  @0 2 @0 "@0 2 @0 "400H00S 400H004ᾬ0S 7?O 0s @0 @080R :@0 @080@44P਷ @0 @080@44$7?O0 @0 0R" 400|0>S 410ḷ0000(00 0 000004 0㶴000 @0!@080R&:@0 @00R 400|0>S @014!  ᆷ400H00S 400H004Ჴ0S 7?O Kt0K 4 0U 400|0>S 4|00 ] X7?OR? R R7?OR ꌲh}|}}~<~l~~~~$DX$tȀt0s7?O0 00R000 0!< Sj @0$ 004c7?O0 400H00S 400H004@0S 7?O@0$ (0R! 400H00S 400H004ừ0S 7?O400|0>S- @0$04! ( ۶%@0!@080R030#\0 400|0>S @0!@080@44@0!@080R*:@0 @00R$4@-00 00 400H00S 400H004Գ0S 7?O0S  7?OR4@ &|0S" @0 "|0 @0 "400H00S 400H004ᜳ0S 7?Ok@0 2 @0 "0S, @0 26`0 @0 26:@  2400H00S 400H004 0S 7?OE`0S 4d d0S 0Sd00 400H00S 400H0040S 7?O"0S 4@(  400|0>S @00@ $@  " 4%  p0S p0  0KH-MK@  0 00 00 00 000 0H0 0 00$0 $0<0(0 0 2<SU 00|0>S ;0õ00<00S 00<000S 7?O( X0K0 00<00S 00<00j0S 7?OX0K    ,00S 00H0S 00H020S   0r00S00,0 ,00p0 ,00l0 ,00h0 ,0 0d0 ,00`0 00 00pK夰 0S 0Kp0K00 00H00S 00H00{0S 7?O600|0>S 00 0$0.00 0$0RW*00|0>S 00 0$0p 0$0\0 00H00S 00H00֩0S 7?O 0 0S P0K \0KP0 0L0 \ K0KK 0 0S 0P0K 0KP0 0L0 00P K    q000 0$0R00|0>S 00 0$0༴  &00 0$ 0 2 0 " 0 "00@0@0S  0 2% 0 "00 04 00 08 00 040R00 04 00 080R00 08 00 040R 00 04 04 000R 040᪬ 0S 00|0>S< 50 _< 0 2 0S 00|0>S, P50N+ 000       0S 00|0>S 00$  /00 00|0>S 00 0 00s0S 4040 0    0  D40  0 00S00|0>S 0 00     000  0       0 200S00|0>S 0 2<#  ³6?O0 0040 X0K  0 040R: 00S 00|0>S 20ᡳ00|0>S 0 40R20`20l" 4 勳 0$00 0 2 0 " 0 2 0 " 0 40R+ 0 0A?  00|0>S 0! 080_ 0! 080R4: 0 00R0 00 +00H00S 00H00 0S 7?O400000040 00000 0800H00S 00H000S 7?O0S    0KS 0 2<S 4040P$  IJ0 2<SO P00<00S P00<00P0S 7?O 40K0 P00<00S P00<00Pf0S 7?O01 0!40K   P #P00S P00H0S P00H020S P 0P00H00S P00H00Pᛯ0S 7?O0$0$0 T00SX00(0 (00H0 (00D0 (00@0 (0 0<0 (0080 X00 X00HKP六 0S 0H0K,0 0 "00@0@0S,0 0$0R:P00|0>S ,0 0$0P6?O0 I,0 0$0R P00|0>S ,0 0$0Pt00 20A?,    P\ N 0S 00 P00|0>S 0!080Pٱ0!080R :0 00RPIT7?O0 P00H00S P00H00Pᆦ0S 7?O  T7?ORP$ Z 0K4`H-0M   $0 0000@0S 0000 000 00 0 0 -0 0R 00|0>S 00     !  g0 0R:060 01 00 0 01 00 $0 0R00|0>S 0 0R1020    T   050  0 $00 $0 0KȃH-MŸ    0 0 00R 0 00R*000 00R 0 00R*0000 00SN0S00s0SF 0S 00S" 0S00S 0S 00S 0S0S\0 0R :0 0RT0! 0RQ*00|0>S 410ᷰ0  0 0 00 0 !500S10S00s0S 0  0 0 0 00 !0 0 0 0 0 0 !KЉH-@M( , 0 40 (00 0 0H00 00 01 0!0 2<SV (000 0<00 (00<00S (00<00(x0S 7?O  0K0 (00<00S (00<00(0S 7?O 0K   ( 㵧(00S (00H0S (00H020S (啩 01 0!T7?Ow(00H00S (00H00('0S 7?Od0S 0 2%0 0 200S0 20S 004 0400S500 ,0R*(, 0S(0 2 0 "0 2 0 "0 "00@0@0S0, 4 00 8 04 ,0R*0, 4 08 00R*00 8 (00H00S (00H00(V0S 7?O0KH-M00     ",R  "   !   | .R  ( 0 0VKDH-M   00H00S 00H00v0S 7?O 0 0R*  0  00H00S 00H000S 7?O0KH-8M0 4 8 <0 0000 0H0 0 0$0$0 0 0 0(0 (0,0 ,00 4000  @;L0@R 0 S < S ,0 (00y$00s , $00R( $00RX, $00RS$0<  $00, K$0$  0 $0$   ! $0$  !  $0 9 ;CR $0  $ $06S $0 $00$P$ $P 0$04 0 000H00S 000H000Р0S 7?O0 K0Px<`-$M  $0 00 0 000@0S 0 0 00 0 000 00  010b1 00 0 0R 00s$0  000 04 0RЋ/H-TMD@P T P00 0 00 00 P00$0 $0H0(0 P00,0 ,0<000 P00<00S P00<00P˨0S 7?O0 D0K P00<00S P00<00PF0S 7?OP00H00S P00H00Pᠨ0S 7?O(040040 L0KP ӥP00|0">S L0H  P# 4 I 000@0S (0 0 00 (0 0080 00 00 X 010b18 0<0 <00s" P00|0">S <00< <   P4"  P00|0">S <0 0 <00P<00s" <0 L0R<0 H0R00s0<0 L0R00s0S <0 D0R<0 @0R000 000 (04 0R 40R:P00H00S P00H00Pᑟ0S 7?O/P00|0">S P00 40岪 40R*T0S6?O0 P6 0S0S 0SP 㕦000 6?O0 0K(tЄ$H-PM@ @00 0 0H00 40K@ 0S 0D00K ㊦<0K ㅦ4 <0K@嶩 0S!4< K00K 0O 0S<0K0 K   @  0S @-6?O0 40ՠ 0S 0S00 0KH-(M( , 0 0 (000 0H00 (000 ,0S(00H00S (00H00(D0S 7?OC0 0S( 000@0S 0 000 0 000 00  010b1 0 0 0  0 000 04 0R,0S(00H00S (00H00(ᔞ0S 7?O 0KH-4MA@0 0000 0H00   0KI/00 000|0">S 0 00| 0S0S010 N(0K0 000|0">S (0 $0 0z(  0R$ 0R00s0(  0R00s0S$ (00c 0  $00c0 0S 00C 0  <;C00 @20@0  =b0AC?0c 00 000 0KS 0 0 0><0K U l0K t0Kl K\0K᳚ 0S 0\d K<0K 0 0S\l K<0K 0  0Sl0K< K @    㢝p \000p0 Q 6?ORLd 00R d 00R030#s0 ` 0 0R ` 0 0R:00s0S 00    n00 B\0   0  6?OR0 2<S 0 0 000 6?O0 0S0200 0S K0KK ã 0S0K 㪡00H00S 00H00Ả0S 7?O0P00 0T00 00 <0K0 00H00S 00H0000S 7?O\ K<0K 0M 0S  6?OR0 2<S 00 0R 0R030#s0 0R 0R:00s0S t0R< \ 0Kؤ 0SyX0K 60 0S X0K -0KX0 0T0  K0KK 0 0StX0K 0KX0 0T0 t0KX K @    ㊜0S K K0K<K@ 0S  Q7?OR0K  0p 0S  7?OR!00 t0K Kp \000p0 0S0S 00S 0 SM 0S 0K@ 0S 0S  00 \0# 0S 0S 00 0K`_H-xM` d h l0 `000 0<0 0 l00s0S h D0K D0KB/00 0 0 00 00 l00S 00S 00S h0S h0 00Rh0 00R 0 0 l00s0S2 0 h00R 0 h00R0#03s0 0 h00R 0 h00R*00s0S d0 28S 0d 0  0 0 00S 00S00 <0K  L0K d0 0S <0K 00<0 080 L KX0KPK` 0㘙 0SG<0K X0K<0 P080 <0K0 l00S 00 00 00 00D K00 d00s d01 d0!d0 28S 0 0 d0 D0K ` - 000000` 0!0KH-M|A@  $0 / 0SD$ Л 0S=00H00S 00H00ᐠ0S 7?O50 0 00S 00ᐠ0 0 2(0 "00H00S 00H000S 7?O 000ڞ00K4SH-|M@C@h l p t0 00 h000 0<00 40K h00<00S h00<00h,0S 7?O X0K0 h00<00S h00<00h᧗0S 7?OX t00Rt000X0 0T0 X K40Kl 0㺜 0S X K40Kl 0㯜 0S% h00|0B>S t0 t0 0hঢp0 2<S 00 t00   h 2L6?O0 HT l000T0 \0Kl: 0S:P0K 㘞p0 0S P0K ㏞\0KP0 0L0 \ K`0KdKh 0f 0S 0P0K v`0KP0 d0L0 X0KP K @   h 6?O0 0KQ$H-M 000 0KT 0S 0(0 0 & 0  Z0b0v,>0[0o,00S ,00H0S ,00H020S 401S,h>0@0T,0S ,00S ,0000S ,0010S,ɕ0=,080S0p0 p0K, R@ @0S @0+,( (0S,00H00S ,00H00,j0S 7?O40 29S ,00|0B>S ,=0,00H00S ,00H00,ړ0S 7?O,4 ㇝( (0So40 2<S<0S 40 20S<0S00D0 D0S ,4帜( (0SS0$0 ,00H0 H0<0L0 <0SD0Sa ,C( (0SA40(0 40( 40$ 40(0R40$ 40( ,00S ,00H0S ,00H020S 40 2<S,D;0u0(0 40 2<S ,4 40 2,40 "40$ 40(0R40(0 40$ ,00|0B>S 40( 40$0,{40(0,8( (0S,00Sg ,00H0Sb ,00H020S[ D0S40 26SS,( (0S ,900(0 401`p40140 1 0  0z 0X0P0 P > 3D#9 40!P> 3D!#9@" @0c/ 40!L0 L0 4040,͛( (0S}40 40 40 2 :T0 T0=T0 40T  "L0 0t0 ,00|0B>S t0,`(  L0 0S ,=( (0SV40 40 2)40 ",00H00S ,00H00,ᔒ0S 7?O,00<00S ,00<00,0S 7?OL l0K0 ,00<00S ,00<00,i0S 7?O}l0K   , +0(0 D0S, 0 0 ,0000X0 X0 0S ,\ \0S (0S\0(0 X0 0S ,5\ \0S (0S\0(0 ,ㄙ( ,X\ \0S (0S\0(0 ,\ \0S (0S\0(0 ,00H00S ,00H00,s0S 7?O40 2 *40 "0$0 ,00H00S ,00H00,0S 7?Ox ɒD0S400s00`0 D0S 40  40 "6;O0@0T0 T00T0 D0S$ t0K,1( (0Sk,00|0B>S t0,P$  t0 S t0,!t0, 0t0 t 40 40T  ",00Si ,00H0Sd ,00H020S] D0S40 26SU,㠐( (0S.401`p40140 1 0  0D 00P0 P > 3D#9 40!P> 3D!#9@" @0c/ 40!40 0S 8000@0S 40 080 40 008ᬔ40 ,00H00S ,00H00,!0S 7?O5,A( (0SD0S4 d0Kx 㻗( (0S400S 400,m0S 7?Od p0 H10Ӑ400S 400,0S 7?O0 0 ,00H00S ,00H00,=0S 7?O40 2)40 "$0S 40 2 *40 "0$0 ,00H00S ,00H00,ᮐ0S 7?OdD L؇@`Ĉ`0S ,00@0S 40 ( ,|( (0Sb|000000, 0RW000000, 0FK,00H00S ,00H00,Ϙ0S 7?Ov 40 2)40 "$0S 40 2 *40 ",00H00S ,00H00,30S 7?OG(0S*,00H00S ,00H00,ი0S 7?O*40 2&40 ",00H00S ,00H00,0S 7?O 0S ,  ,| 0p0S p0  (0KЋH-\M(C@@ D H @000 @00 0 0H0$0 040 H0S200 0D00 200 $000 00S 0@0S @00S @0000S @0010S@H0@080S080 80K@ і( (0S (0yD0S 40K 6 0SO4 80 0^40K " 0S=H0S 40d10᝘ 0S240= 0S,@00;S 00,0 48 H0S000,000 000 0 0S 4 0 40S 40 &0 00S 0S000 0 0K1H-0M( , 0 00 ,00 0 0000 00 K 00 K   0R0  0R*0  0R0 0R*00KH-M 6?O K 6?OK000 0000 6?O K000 0<00 0 0S0Z0 0 Og-K B( Bg=K0C,0C K2 8 0S 0C00 0 0201 g=K0C(0C0$0 $000 0S 0+ 6?O K00H0t  Bt 6?OK00H0 00 0 0 C0 000 6?O K0 R0 0 6?OK02S 0KH-|MI@x x000 0H00 00S00S x00|0B>S x<90o0F0X0 0\0 0d0 0`0 0L0 0H0 0T0 0P0 D0Kx 0S 0,@0K jDT K@0K 0= 0S xx80 0 T0R*x00|0B>S x880,0 0 T0Kx 0SBDT K@0K 0  0S T P0xۘ@ \0Kx  0S\ L0K \0xE0S T P0xD྘DL K@0K 0ܒ 0S L H0x૘DT K@0K 0ɒ 0S  6?OR00 x60ᑘx000Sl0K@  l0K0@  l0K0@  l0K0@  @00l K ΍l0S DT K@0K 0㈒ 0S  6?OR00 D0S6DT K@0K 0o 0S xX50?/x000Sh0K@  h0K0@  h0K0@  h0K0@  @00h K |h0S DT K@0K 06 0S  6?OR00 0Sl h0XKx㓖 0Sx00x  L @ L DT K@0K 0  x000Sp0K@  p0K0@  p0K0@  p0K0@  @0p K p0 S S/ s@ `0Kx ז 0S`00 00 `00 0 `0x!X t0Kx 兗  6?OR X0T K x  0Y H0SD z@ d0Kx b 0SmXd00 t0Kx`  6?OR$d00S Xd00 d00TKx. @0Kx+ 0S0t0 0t d0T Kx o 0S:d0xĔDT K@0K 0c 0ST L0R T L0RO* P H0R P H0R:00s0S@ 6?OR 00 D0؍$ x00x  L @ L X0S X0xC0S$00K|+(@hH-(Mp20 $ (       R H R "0,ٖ0~00Sk 00H0Sf 0H00 0S 00S 0000S 0010SJ0[080S00 0K Ӓ 0S 0I00H00S 00H000S 7?O6$0S 0P $0 (0S 0T (0 00H00S 00H00d0S 7?O0S 0  $0S 0 $0 (0S 0 (0 0K!0H-(M\20 $ (       R H R "0,60y(0S(0#?$ 0$0 (01(0 00Sc 00H0S^ 0H00 0S 00S 0000S 0010S圌0K080S00 0K % 0S 0900H00S 00H00D0S 7?O&0$ P 0( T 00H00S 00H00ᾊ0S 7?O 0S 0   0$  0(  0K HH-M00         R H R 0,㙕0"  R   H R H   R   "&R D 0r00 @  0 ( 0K`x-M  000 00 0 00S 00H0S 0H00 0@ 0  0( 0 0Ћ/-M  000 00 0 00S 00H0S 0H00 0 <  0 8 0Ћ/-M  000 00 0 00S 00H0S 0H00 0< 0  08 0 0Ћ/H- M20       H     BRa_^$[Z2 00S 00H0S 0 L S0 4 O 00S 00H0S 0 D B0 , > 00S 00H0S 0 H 10 0 -  R  H R   "&R    0ፔ 00S 00H0S 0 ! 0 <  ( 0v00 0KH- M10       H    BRKIH$ED200S 00H0S 0L0 040 0900S 00H0S 0D0 0,0 0(00S 00H0S 0H0 000 000S 00H0S 01 0<0 0$ 000KDH-(M30 $ (       R H R0#0,000S 00H0S 0H00 0S 00S 0000S 0010S^0080S00 0K  0S 000H00S 00H000S 7?Oz$0S 0X @20@ $0 $00\ =b0AC?0c $0 (0S 0` @20@ (0 (00d =b0AC?0c (0 00H00S 00H00V0S 7?O70S3 0  /$0S 0 @20@ $0 $0 0 =b0AC?0c $0 (0S 0 @20@ (0 (0 0 =b0AC?0c (0 0KH-0M40( , 0 (       R H RH$0,0, R 0, Q*$0000S 00H0S 0H00 0S 00S 0000S 0010Si0080S0 0 0K  0S 000H00S 00H000S 7?O, > 3D#9 0X ,> 3D!#9@" @0c/ 0\ 0 > 3D#9 0` 0> 3D!#9@" @0c/ 0d 00H00S 00H00e0S 7?Os00S 00Ï0S 7?Od000 0S 0<00 0S , > 3D#9 0 ,> 3D!#9@" @0c/ 0 00S 00%0S 7?O3 0S/ 0  +, > 3D#9 0 ,> 3D!#9@" @0c/ 0 0 > 3D#9 0 0> 3D!#9@" @0c/ 0 0K`H-(M020 $ (   ( R"0֑0x$ R!0̑0n00 0 0( @ 00S` 00H0S[ 0H00 0S 00S 0000S 0010SC0E080S00 0K ̍ 0S 0300H00S 00H000S 7?O 0$  00H00S 00H00h0S 7?O 0S 0   0$  0K -$M  000 00 0 00S 00H0S 0H00 0!0 0 ! 0  0 0 0 0 0Ћ/H-(M20 $ (        R H R"0,0$ R ( R( R$ R L"00 $  ( $( Q*"00z  Ro   H Rj H    "&R !0ΐ0b0S 00S 0000S 0010SW0K080S00 0K  0S 0900H00S 00H000S 7?O&0$ !0(  !00H00S 00H00y0S 7?O 0S 0   0$  0(  0K `|ȌH-XM10H H   H R !0,Y0h 0S 00S 0000S 0010S ֆ0Q 080S0@0 @0K  _ 0S 0?40K Մ 0S 0500K _<0K Z4< K00K 0- 0S <0K0 K    Ƈ40ῆ 0S 0S00 @0S @0  0KXH-PM40@ D @      H Rl$0,ҏ0000 0<0 0 00$0 $0H0(0 00 0S 00S 0000S 0010SA0080S0<0 <0K ʋ, ,0S ,0(00S (000S 7?O 80K (00S (00l0S 7?O00H00S 00H00ƌ0S 7?O(0000 00s00H00S 00H00@0S 7?O000000 0x(0 20S00H00Sf 00H000S^ 7?Og(0 2 (0 "80S#40S (020S (0 2:;(  26?O0 00H00S> 00H000S6 7?O;00H00S 00H00݃0S 7?O(80S40S00 0 0 00 0 0 80K   0 吆<0S <0  0Kxl-M  00 0 S00 S0 0 S00S00Ћ/H-MO@  0 00$0 $00H0S$?0,ゎ00S 00S$X?0h0$00S $00H0S $00H0 2<S$00S $00H0S $00H0 20S$>0A0d$均 0S$喇 0S $ 0,$\>0'0J00 00 00 $00(0 (0H0,0 $0000 00<040 $0080 800<0 000@0 @0S-00D0 @0SD000S D00 D0 D00 D0 D000 D000 D 0K D000 D000 D000 00 00 0@0S00H0 H000 H000 H 0K H000 H000 H0 00 H000 H000 00 00K$΄ 0S 0 0KL0 0S 0 0  $0S $00S $0000S $0010S$'0 $080S00 0K$ 㰉P P0S P0 $00|0>S 00$L ;0FL00S6L00S L00$+  0T00 $00|0>S L0 L00$sL0 L00ᨊ L0 $00|0>S L0 L00$t[L00S L00$L*  000 L00 SL00 S L00$*  0 00 $00|0>S L0 L00$(L00S L00$)  000 { $00H00S $00H00$C0S 7?O ,0 29SQ $00|0>S $80L0 0 0S 6?O0 $00H00S $00H00$᫁0S 7?O ,0 20s0S L00S L00 S L00S L00S ,0x1 ,0x!,0|1 ,0|!000000$ 0M ,0l0 ,0l ,0(00 ,0 2:T0 <0H0X0 ,01 ,0!$00H00S $00H00$X0S 7?O{ $00S $00H0S $00H020SL0 00SL00 S$608$00|0>S $60]00 $ L0 0R!*L00S L00S L00S L00S L00S ,01 ,0!L0 0 0Sf 6?O0 L0 0R,0 2<S) ,0X1 ,0X!6?O0 $00S $00H0S $00H020S o L00S< 000000$ 0㛃_ L00S L00S L00SM$00H00S $00H00$0S 7?O $00|0>S L00$h$  ΋,0  L0 ,0( ,0(00 $00H00S $00H00$Ⴠ0S 7?O L00S!000000$ 0AL00S $,0S 000000$ 0+ L0 00S* $00H00S $00H00$ᲈ0S 7?Oh ,0 2@ ,0 "$00H00S $00H00$-0S 7?OP L000CS} yTv &t a H3  Q W L00S0000 00 00K$ 0S 0 $00H00S $00H00$I0S 7?O $00|0>S ,0$0$  ,0$0R $, b ,0$ ,0 2 ,0 "$00H00S $00H00$0S 7?O $00<00S" $00<00$0S 7?O 8܍h܎HS $ 40ᯉ$00S $00H0S $00H020S$00|0>S 00$L 40B000000$ 0%6?O0 0X    $L 03 ,0 20S7$00|0>S $050f$00S $00H0S $00H020S$00|0>S 00$L 50000000$ 0܀6?O0 0  $ L0J ,0 2<Sm 6?O0 ,0 20Sf$00|0>S $p60$00S $00H0S $00H020S$00|0>S 00$L 60ੀ000000$ 0㌀6?O0 M,0 2<S$00|0>S $h70و$00|0>S 00$L 70|00 ,$L 0 %,0 20S*,00s& T0S0 ,0 28S L0 ,00R L0 ,00R*L0 ,00R L0 ,00R:00s0S ,01 ,0!L00$, ( ,0 20S7$00|0>S $80t$00S $00H0S $00H020S$00|0>S 00$L p90000000$ 06?O0 0X    $L 0% $00S $00H0S $00H0 20s0S T0S ,01 ,0!L00$,  ~L0 00S. $00H00S $00H00$A0S 7?O<0@0 <0@ <0D0ᨁ$00H00S $00H00$|0S 7?O$L 0嶅 ,0 20s0S! ,0x1 ,0x! 6?OR,0|1 ,0|!L00$, g ',01 ,0!,0 2<SM $0000 00<040 $00<00S $00<00$߄0S 7?O4 0K0 $00<00S $00<00$Z|0S 7?O}0K   $ $00S $00H0S $00H020S $y<0 L00    $ ~y<0 ,0 20s0S $00H00S $00H00$င0S 7?O6,0$00 ,0 0R,0  ,0 29S$, 㰅 0S 00 00 $00H00S $00H00${0S 7?O,00S ,00$A0S 7?O$00H00S $00H00$.0S 7?O,0 2 :S $00|0>S $D?0߆$, ,0 2*,0 ",00S ,00${0S 7?O 0S 00 $00|0>S4 $?0 嵆.,0 2),0 "00 $00H00S $00H00$l{0S 7?O,0 0S x0K 㭂0Kx0 0t0  K0KK$ 0z 0Sx0K 㖂0Kx0 0t0 L00x K   $ ~$00S $00H0S $00H0 20s0S T0S ,01 ,0!L00$,  ,0 2<SG $00<00S $00<00$o0S 7?O%4 0K0 $00<00S $00<00$z0S 7?O 0K   $ }$00S $00H0S $00H020S $,0 20s0SB L0 0R?*$00H00S $00H00$0S 7?O,0$00 ,0 0R,0  $00H00S $00H00$z0S 7?O,0 0S x0K ҁ0Kx0 0t0  K0KK$ 0y 0Sx0K 㻁0Kx0 0t0 L00x K   $ .},0 20S*,00s& T0S0 ,0 28S L0 ,00R L0 ,00R*L0 ,00R L0 ,00R:00s0S ,01 ,0!L00$,  ,0 20S7$00|0>S $P?0A$00S $00H0S $00H020S$00|0>S 00$L >0|000000$ 0|6?O0 x0  K $L 0   S7?ORU0K$,X  | _,0 2<S* ,0 0R% ,0X1 ,0X!6?O0 $00S $00H0S $00H020S ;000000$ 0k|/$L }  T7?ORL00$  ,0 20S7$00|0>S $<0ᩄ$00S $00H0S $00H020S$00|0>S 00$L x<0<|000000$ 0|6?O0 0  $ L0區  U7?OR00 ,0 20S7$00|0>S $;0[$00S $00H0S $00H020S$00|0>S 00$L @;0{000000$ 0{6?O0 0  $ L0| $00S $00H0S $00H0 20s0S T0S ,01 ,0!L00$,  g$00H00S $00H00$/0S 7?O<0@0 <0@ <0D0}$00H00S $00H00$x0S 7?O0  $ L0 ,0 20s0S ,0x1 ,0x! 6?OR,0|1 ,0|!L00$, R ,0 20S7$00|0>S $80ឃ$00S $00H0S $00H020S$00|0>S 00$L L801{000000$ 0{6?O0 ,0t1 ,0t!$P $00S $00H0S $00H0 20s0S T0S ,01 ,0!L00$,  ,00S ,00$v0S 7?O,L0 401R L0 401R*00L0 40 1R L0 40 1R*000\0 \0S,00S ,00$w0S 7?O00 d,01 ,0!L0 ,0x0R L0 ,0x0R030#s0L0 ,0|0R L0 ,0|0R:00s0S ,0L x0 $00|0>S $d50ɂ$00|0>S 40!40 1,x,|$ൂ,00S ,00$xw0S 7?O,0 20S7$00|0>S $40ᖂ$00S $00H0S $00H020S$00|0>S 00$L ,40)z000000$ 0 z6?O0 $L 0w ,0 2<S$00|0>S $30R$00|0>S 00$L \30y00 $0080 800<0 $00H00S $00H00$g0S 7?O<0@0 <0@ <0D0{$00H00S $00H00$v0S 7?O$L y jT0SJ ,00S ,00$30S 7?O40 L00R 40 L00R*0040 L0 0R 40 L0 0R*000\0 ,00S ,00$v0S 7?O\0S L00$, \ ,0 20S7$00|0>S $00ᨁ$00S $00H0S $00H020S$00|0>S 00$L t00;y000000$ 0y6?O0 X00$L 0z ꄑܐT,,0 20S7$00|0>S $H00[$00S $00H0S $00H020S$00|0>S 00$L 00x000000$ 0x6?O0 $L  $00S $00H0S $00H0 20s0S T0S ,01 ,0!L00$,  k$L } ,0 20s0S] ,0x1 ,0x! 6?ORU,0|1 ,0|!L00$,  I$L 0u B$L 0hy ;L00$l"  ៀ00 0.,*(&$"  $00H00S $00H00$}0S 7?O}0S ,0 2),0 ",0l0 C,0l $00H00S $00H00$7u0S 7?OZ0S8 ,00S ,00$}0S 7?OHL 0K 0K$ | ,00S ,00$ u0S 7?O.$00|0>S 0$-0SL0 0 0S 0S 0L  S 0 0 0,00H00S 00H00s0S 7?OF,00S ,00s0S 7?O7,0h0 ,0h 0$0 00|0B>S ,0h0\+  ~00H00S 00H00s0S 7?O0K00K0 0^ 0S800 1y80 80 FX K0K 0SX00 000 000 0K0 0K00K0 00 0S,0,1 C,0,!808 0,80, 0X  6?OR800 x0 0  0S` 0S 80!800R80 !800R 800S800S 80!800R80 !800R ,u0S 00, 0y 0S >80, 0X 80 80 0S ,0Sڸ00H00S 00H00r0S 7?OQt0K "z0t0 $0p0 t0K    4 ss 0S,0,1 ,0,!80< ex,01 ,0!,0!,0,1R*,0,!,0! 6?OR0 0 0S800S800S 0 800R 0 800R:0 800R 0 800R*00s0S 80 0 , u0S 00, 0`x0S00 0 0S 0S0 0 0S 0K ,0 28S9 ,00S,00S1 80!,00R 80!,00R030#s080 !,00R 80 !,00R:00s0S 0 K,0 ,0 00 00 S7?O 0 $0S ,0h0 C,0h 00|0B>S ,0h0"  | 0S,0 28S0S0S 0S 0 K6?O 0 800 K 0S 6?OR#,001S,0 28S0S0 00S0S0 0@0S ,0 0!00 ,0(00 ,000 00H00S 00H00p0S 7?Os,0x0S,0|0S4 80!,0x0R 80!,0x0R*'80 !,0|0R 80 !,0|0R :0 `P|0`0s0S , 0Kx ,0 x ,0 | 00 00 6?OR;00S7 00H0S2 00H020S+ 0S0S% 0K=x< <0S <0 0  800R 800R00s0 800R00s0S 800 K,00S ,00np0S 7?O0S0S/ ,00S ,00x0S 7?O00|0B>S 0({{0K Mw< ,00S ,008p0S 7?O0S 00|0B>S 0 0 0U{  < <0S <0 0 " 0S 00S80@1S rX0S X0y0S 0y 0y s- y s&/OS GS'/OS SS @00|0>SN 0{L00|0>SA 0 00,z;,0 28S 0S0S 0S 0 K00|0>S 0z00|0>S 0    $  z 0KH-M G@  00 0 0H0$0 0t0 00 00 00 00 0S 00S 0000S 0010Sp0080S00 0K v( (0S (0H0K v00;S 00@000 000S0K   0K0   0K0   0K0  00 K to0K Yv0 SC$0 0S0 0K $y 0S 0700S 0ow0- |0K 000 40 0K n 0S 000S 0Ow0  |0K 000 0 0K p 0S 0 |0K 0D00 L0K o 0SL0   0Jx 0Sd| K0K  0S\ 0 830 v0 K  0x 0SHt0K/n 0SB00 00 2t H0K 0s 0S 0 00\y*0 H0K 0Yx 0S 0 00$Cy000 000 0Rl0K wu0l0 L l0KpK `t, ,0S 0S,00 L0p, ,0S 0S,00 0S 0~v0S 0wv0S 0pv0S 0ivt0S t0o, ,0S 0S,00 0S 0w00@0S H0S H0w0S$01 $0!0K`[ԓH-TMHD@P T X D0K t,0@0,0 0KP]m 0S 0P000SH0KD  H0K0D  H0K0D  H0K0D  D0H K mH0 SD 0KP x 0S (0K  T0 0Pu(0KPX  xX0 X000R*X00S X00000 0!X00P v 0SX0  X0X00! T X0 P000ST0D  T00D  T00D  T00D  T D00 nmP000ST00D  T000D  T000D  T000D  T0 D0 0 Em0S$T00ST00S D0KT 0q 0S* 0S T0 T00P|w 0n 0S 0S00 D0S D0Pv0K- M  0 00R 0 00R*000 00R 0 00R*000Ћ/H-S 4000x#  pw400,0 400S8000,0 800 800,K0ew 0S 0000|0B>S 400 ,00Ew000H00S 000H000qt0S 7?O0 2+0 "000H00S 000H000k0S 7?O00S 000k0S 7?Oq000<00S 000<0007t0S 7?O^,0( K em 000<00S 000<000k0S 7?OD00S 000t0S 7?O5000H00S 000H000s0S 7?O"0 2+0 "000H00S 000H000vk0S 7?O 0S0B?( K 00K`H-,MB@( , 0 (000 ,0 0K( |u 0S 0k $0K 0(s(00H00 00S 00(1k0S 7?OO l00S 00(s0S 7?O<$0K( r 00S 00( k0S 7?O' k0S000(o $  0(du(q 00S 00(Os0S 7?O0K萟H-0M $ ( ,0 00 0 0D00 0K $ j 0S 0%(00@ (0 ,00@ ,0 0(, 8k 0S0q 0n 0S 0S00 0KH-hM` d `00 0 0<00 `000 0D00 $0K d i 0S 0D\0K qD0 0D0 0P0 P0T0 @0K q$@ K\0K 0|k  6?OR 0S 6?OR0 0 @00 0 0 $0$n 0S 0S 00 0KH-MF@  0 000 0H00 0D00 00 00S  0000S0K   0K0   0K0   0K0  00 K Mj<0K 2qt0K -q00|0 00x0 0 S0 28S 00 0j 0S 0F01 0!0 28S 0  00C S <t000S0K   0K0   0K0   0K0   000 K i0S0 00 ws 00 0P00S  0l 0P0 0P 0S n  6?OR 0S 001:S0s 0Su 0 0 05tp os 0 0 00|0>SZ 0 00|HtVX0K ^p0X0 $0T0 X0K     i  6?OR 0S 0  S $0$0 L   n0 Tf0 l0K踁H-$M A@ $ 000K0 00 0Hk 0S 010-  K  2j 0S $0KK  0h 0S0 2h 0S 0 <  c0 f0 k0KH-$MA@ $ 000K0 d10 0j 0S 0K0  d0S $0 ( $0(0 c 0S20-  K  0j 0S# $0(0K  0th 0S0S 00|0B>S $0(0 L   n0 e0 Lk0K~ H-$M A@ $ 000K0 00 0j 0S 010-  K  20j 0S $0KK  0.h 0S0 xg 0S 0 <  b0 He0 j0K } H- M`10       H R,!0,mm0A !0 0Sl 0S 040S 00S 0000S 0010Sc0080S00 0K fi 0S 0   0S 0  0K{,H-8M0 4 8 0000 0H0 0 0000 0<00 40 (0K0 j 0S 0' 0 2:S000 (  0K? Lb 0 20S (0  0 2 0S (0 (0  (0  (0  (0  (0 0 (0 ! (0 8 (0 ! (0  0 (0 < 4 (0 4 (0  p (0 ( T (0 $ X 0 2<S (0  0 20s0S (0  (0  800s0S 0,1 0 001$0 0K? h 0 ! 0! 0! 0! 0,! 0$ 0!0S 00S 000i0S 7?O 0 20s0S" (0  0B/(0 0 (0  $ (0  ( (0  (0 =b0AC?0c0B 0 2<S+ 000<00S 000<000i0S 7?OF(0  00 000<00S 000<000a0S 7?O-(0 (0  (0  (0  (0 (0 (0 0 0S 00S 000`0S 7?O( 40 0KH-MX10       H R(!0,k0@!0 0j 0S 030S 00S 0000S 0010S4b0080S00 0K g 0S 0 /k 0S 0  0K8u@H-M  00 000 0S 00S  0S 0S 0 00S  0S 00KH-$MI@ $ 0K $  0S 04$00S 80j00 00S S  80j 80j00  h80j0 00S <804800 (80 0j0 000S70700 70 0j0 0 00S70700 70 0j0$0 |'  h0(0S\70T700 0(0 @'  0j0,0  '  |h000s 000 &  ph 60nj040 &  bh0T0 &  Zh0X0 &  Rh0\0 p&  Jh00 T&  Bh0`0 8&  :h0d0 &  2h0h0 &  *h0l0 %  "h0p0s 0p0 %  h 50j0t0 %  h0x0 l%  h0|0 P%  g00 4%  g00 %  g00 $  g00 $  g00 $  g00 $  g00 $  g00 p$  g00 T$  g00 8$  g00S 40i 40i00 #  g00 #  g00 #  g00 #  yg00S p30ti00S00SP 0 00 0diG00 #  Wg00 "  Og00 "  Gg0 00 Ci00 "  7g00 "  /g00 p"  'g00 T"  g00 8"  g080 "  g0<0 "  g0@0 !  f0D0 !  f0H0 !  f0P0 !  f0L0 t!  f00S00S 0 00 0h0 g0K sX 4@hؖPXԗ4`DXpԙ4TlԚ@x̛0H`Ԝ4`t Lh̞H-TM@I@P T P000 0H00 P000 000 P0S P00S P0000S P0010SP,_0'P080S0,0 ,0KP d 0S 0`800PT(  BhP@80=h0D0S0D0S80 80P(  70(h0D ,0T e0P0 '  P 70b700Pt'  hP|70h00Pd'  T0c00PD'  T0b00P$'  70g00P&  60g0$0P&  60g0(0P&  60g0,0P&  60g000P\&  h60g040P4&  D60g080P &  60g0<0P%  50g0P0 T P%  0]0X0P%  50g0\ =b0AC?0cPL%  p50sg0`0P$%  L50ig0d =b0AC?0cP$  50Yg0l0P$  40Og0p0P$  40Eg0t0Px$  40;g0H0S 0H H0K3e0l40Pd$  'g00P#  840g00P#  40g00P#  30 g00P#  30f0 00Pf01P(#  30f01P#  `30f0 2 "  P 030`200Pt"  fP30f00S 00PRd0S 7?OP00$0 $0<0(0 (0 (00Plf(0 (00hP@f(0 (00@Pf(0 (00Pf(00Ph!  10zf(0 =b0AC?0cP(!  10jf(0!(0 1PT_f(00P   \10Uf(0 =b0AC?0cP   10Ef00S 00Pe[0S 7?O0Khd04PTXd|HԟܟP8TdР4LhlС4ܡX$Dd| H-dM(F@X \ ` d0 X000 0H0 0 00 00 0$0 00S, 00Xuc0S& 7?Og 00S 00XZ0S 7?OXX !b 00S 00XSc0S 7?OE\0000s0S\0 $0R[*X00|0>S \000X40$ $0e 0h1 0h!X\ a 00S 00XZ0S 7?OQ7?O X00|0>S \0 \00 0X40$ $0e 0d1 0d!X\ a 0S 00S 00X}Z0S 7?O0\00 $0 \00R\0 0S 00 00 `0S@ \00 X` 0,] 0S 00S 00XIZ0S 7?O0`0 0RX00|0>S X|20$ $0ce 00S 00X&Z0S 7?O0\0 \00000 00L0 d H0K0@K\000S\0d 0 0 0S0P0 00 YZ000 d RZ000 0 00 GZ00 00 \00L KPKX d 0S"\00P \   b 0l1 0l!0 0S X00|0>S X00dX\ ` 00S 00XY0S 7?O0K^LȤH-LMA@8 < @ <000S0h8000 0H00 <00<   40K `<0040 <00000 00S 008aY0S 7?O@800|0>S 0 008d0p1 0p!<0<0 <004K@8\ 0S 7?O0 00S 008a0S 7?O <00 <00<   0K\X,H-M   0  Z`0 0 0 0& 0 0 a` 0S 0 0  0 0  0  0KH-M   000 0H00S 0H00S 0 0   % !c0S(0;0 0$  0Ic2_0-00 0 00 $0 00 0(00 0S`0K }_`0K0 00 0 0S 000 1 S0@0S 000 1 S30 0S/100S0K  0K0  0K0  0K0 00 K OX0 S 0 S0 00 0 2@0S 000 0 0S 000 10S+ 10H0S& 10H0 2<S 10S 10H0S 10H020S 0 0S 000 0K T]00 00 10|0>S 0K   20wZD0K ^0 0S 0 0S 00S 000 000 00 00 0K K00 00 00 0KD0 0@0 ,0 0S00 00 |0K K0t0 0p0 0l0 0h0 0d0 0KD0 $0@0  K0KK $0bWD0K ^0KD0 0@0 0@D K0K0 S X00( Rb01 0!01 0!(0KTXȥܥH-MO@  000 000 0H0 0 00$0 $0<0(0 00 0d0 00 00H00S 00H00M_0S 7?O 0( 00R 0 0R 00,0 ,0S} 0 29S!  v` 0S00 00S; 00H0S6 00H020S/ n\0 00S) 00H00S 00H00V0S 7?Ow0 ]00H00S 00H00^0S 7?O`00Z 0S00H00S 00H00cV0S 7?OD 00S 00^0S 7?O5(00 [(0 0X (0 (0 (0 (0 (0 (0 0D0S Z 0S 00SF 00V0S@ 7?O00H00S 00H00u^0S 7?O 0 2 :S   3[ 0 2* 0 " 00S 00U0S 7?O0S-0S 00S 0000S 0010SpW0080S0x0 x0K \4 40S 400Dx |0K 4Y 0S  JY00|0B>S 0( 00`0 0( 0(0V 0$ 0(0R 0(0 0$ 0  01 0! 0 0!00Z0 0 00|0B>S 0$ 0 0@` 020S 0 2 0 " 0 27;  2 0 2) 0 "00   X00H00S 00H009U0S 7?O 00S 00]0S 7?O ( t0KB/,0S}00  W8 00S 00 U0S 7?O80S3 0 2:St 00R t 00R:#p 0 0R p 0 0R*00s0S ] 0S 00|0B>S 0'  ` 0 2:S*00H00S 00H00+]0S 7?O 0 2+ 0 "00H00S 00H00T0S 7?O0 00S 00T0S 7?Ovt0Sp0S t0Sp0S o 0S _UT7?O\`0K [0 t0R)*d0K"T 0Sdl K`0K 0Y d0(V< <0S 0S<00  6?OR 0St0 l0R:d0KS 0Sid t0K ^ d0V< <0S 0S<00  6?OR 0SQ 00S 00\0S 7?O(00t K(00 Y(0 0X  00S 00S0S 7?O 0 20S t0K     V TT7?O 00H00S 00H00*\0S 7?O0S 0 2) 0 " 0 2:0  200H00S 00H00S0S 7?Ot0r(0D1S 0t0 0p0 0t0 0p0 00|0B>S |10^(0D1S t0KS0t Kt0K 0Y00 0S  6?OR 0800@0 @00D0 00H00S 00H00[0S 7?OD0H0X00H00S 00H00'S0S 7?O  0SNT7?OKS 0 0 x\$0 !$0 !$0!$0$0 $0$ 00|0>S $0$0    v\K9H- M $ 00H00 0000 0 $0R*$0 0 000 000 0$0S 0$0 Y0S 7?O 0!0K Y 0S00S 000@0S 000 000pT000@0S 00 000c 0 0!0K XY 0S*00S 000@0S 000 000AT000@0S 00 000c 00 0 0$ 4 200S 000@0S 000 000T000@0S 000 000T0  0 0 0 0 0 4 0$0S 0$0 tP0S 7?O0KH-$MC@( , (001 0S 0(000 0H00 (000 00 0 ,0SH 0@00s0SB $0K&U 0D0S3 0D0 $0R-(00H00S (00H00(X0S 7?O 0@0 0@ 0 D (00H00S (00H00(P0S 7?O 0@00s0S 0(00H00S (00H00(cX0S 7?Ow00 V(00H00S (00H00(O0S 7?Oa02 0S (x10Z6?OT( V(00H00S (00H00()X0S 7?O=000 88H!0"? c020b1 cR 0((H "?0c(   Z0 2:S0p0 0p (00H00S (00H00(O0S 7?O0K3H-M 001 0S 01000 0H0 0 00H00S 00H00W0S 7?O 0p0 C 0p 00H00S 00H00;O0S 7?O0KH-,MC@( , 0 40 (000 001 0S 0000 0H00 000 00 0 00SH 0@00s0SB $0KS 0D0S3 0D0 $0R-00H00S 00H00[W0S 7?O 0@0 0@ 0 D 00H00S 00H00N0S 7?O~ 0@00s0S 0v00H00S 00H00%W0S 7?Oc0 29S 00H00S 00H00N0S 7?OK40S U6?OA,0S% (0| 0H0R 00H00S 00H00zN0S 7?O%0000 00nY6?O0p0 0p 00H00S 00H00UN0S 7?O0K.LTH-MtB@ 001 0S 0 000 0H00 00H00S 00H00 V0S 7?Ow00 V 00H00S 00H00 N0S 7?Oa02 0S x10Y6?OT  +U000 00H00S 00H00 VV0S 7?O:88H!0"? c020b1 cR 0((H "?0c    X0 29S0t0 0t 00H00S 00H00 M0S 7?O0K0+H-M 001 0S 01000 0H0 0 00H00S 00H00U0S 7?O 0t0 C 0t 00H00S 00H00kM0S 7?O0KH-M@@  0t0|  )  0J 0S 0 0p08  *  080K'H-MH00   h 000:0 00K&H-MH00   l 00090 00K&H-M   0 0 "0 0 "00 )00H00S 00H00L0S 7?O T00H00S 00H00ADGJMPSVY\_behknqtw400 {400 w400 s400 o400 k400 g400 c400 _400 [t400 Wh400 S\400 OP400 KD400 G8400 C,400 ? 400 ;400 7400 3300 /300 +300 '300 #300 300 300 300 300 300 300 x300 l300 0X0K00s0S X0K`M0X K ,30 >K00S X0KPM0X K 20 .K00S X0K@M0X K 20 K00S X0K0M0X K x20 K00S X0K M0X K <20 J00S X0KM0X K 20 J00S X0KM0X K 10 J0@0S X0KL0X K 10 J00S X0KL0X K L10 J`00|0>S `00h h h h h  d  X K `   l0hUK DLX`lxȨԨ(4@HT\ht|ȩЩةH-M    P  O7?OR 00 0 0 0S 0 0  3/KH-pMX \ ` d0 0 0 X000 0H00 X000 0<00 0 27S 0=D0KXI 0S 03@0K Q00S 00X!R0S 7?O00S00S00 0 00S 00XI0S 7?OD\0 @0K 0N 0S00 X000SP0K@  P0K0@  P0K0@  P0K0@  @0P K I< `00R @`0 `00 Q0S00 0S0L0 0H0 D L0KXS 0S:00S 00XQ0S 7?O00L K00X N0 0X 00S 00XI0S 7?OL0K    Xd Kh 6?ORc01 0!X00H00S X00H00XZQ0S 7?OX020S 6?O 0 0 2'0 "0 2'0 "0 0 0 x 0 | 0 0 X00H00S X00H00XH0S 7?O$ 0S000000Xd 0xK\00X :L D0iJ$ $0S 0S$0 0 0KH-@00H00S @00H00@ID0S 7?OC40K@D  0S@ D 0S @00H00S @00H00@L0S 7?O!0 2 *0 "00S 00@L0S 7?O 0B?4 K0 0 0 0 0D 00 0X 00@ I0 0 0D0S@ H 0S 00S 00@C0S 7?O0D0 D "&"00S 00@C0S 7?O0D8 <0K /G 00S 00@L0S 7?O0D0 D "&"@00H00S @00H00@K0S 7?O0 ,!0 2:;  20SK00,0 @00H00S @00H00@eC0S 7?O_,0s00S 00@SC0S 7?OM00 I0 0` 00S 00@;C0S 7?O5000000@, D0E(00S 00@C0S 7?O@00H00S @00H00@ C0S 7?O0KH-8M0 4 8 <0 00 $0K >J+0000S(0K$  (0K0$  (0K0$  (0K0$  $0( K 1C40 0S(0 S (0 S $0K8< 0G 0S 0KH-M000    0M_0K-M 00 0Ћ/H- M  $0 00 0 0 00 00 0KH-M  00 0KH-M  00 0KH- M  $0 00 0 0 00 0KH-M   00 0 0 0KH-M   00 0 0 0KH-M   00 0 0 s0KH-M  00 f0K-$M  00 0 0 00 O7?OЋ/H-,MdA@ $ ( ,0 00 0K$, D 0S 0D00 $( ,0nE 0S  7?OR00 0( !4 040S 0@0S 0000, L00 0( !8 0 0$ A 0S 00 0S0S 07?OK$$H-DMLD@8 < @ D0 8000 <000 00 <0 @0R*7?O00K<@ hD 0S 00040 0 000S 0@0S000# @ qL7?O0 000$0 $0S 0@0SH30@ $0\L00 <0 40K@ L 0S40 0R 0@0S20@ @L7?O0 <00@ H 0S0:S 00<0;S 0@0SX20@ L7?O0 o000 < +< 40Sf0080D 0cD0 0@0S8<E00 0(0 (0SD0S@Q<0 (0R*0@0S10@ (0K7?O0 =00< A 0S00K<( C 0S 0A00 @0R 0@0S 000@    ( K00 (0@0 b00 0@0S 00@ K00< @, ,0S 0S,00 0S0S 07?OKX8hH-8M( , 0 40 (0$00 0$0 00 00 00 0 0 ,000 K$K 0A 0S 0$0 0S $0 ,0 0R$0 000 ,0 $0 0cK 0S 0,0 $0 0UK 0S 00$0 00,H 0S,000 K$K 0@ 0S00S$00S 7?O0 {$0 (02<S (020s0S 00@000 $010 (02<S (020s0S 00@0  (00R(0 (02<S (020s0S 00@00c0 (0 00 sI 0S*0 00 0 00 0  @$0000 ,0 $0 0J 0S0$0 00S ,0 00Rg*0S 00s0S 40  0 40 $0S ,0 $0 0J 0S 0S00 0KH-MH    0 400000  0G0K,H-8M $ ( ,0 00 0 029S 0010 F0Y0@0S000 0S 00S 0000S 0010S @0; 080S00 0K  FF 0S 0) (, 0) 0S 0,      $ (0}  G 0S 0S00 0S 0  0KṮH-$MlA@  $0 000 H10$ 0H 0S 0C$0@0S $0I0S 00 H03 0S00I0)$0 0S 00 nH0B00t00$ 0B 0S 0$00S 0S,00I00KḻرH-K$  #>K0$   #>K0$   #>K0$   $0 0#.K $0 00#.K $0 00#.K $0 00#.K $0 H2 00S 00 00 T2@0S$0 0 <'  G0S3 ?K$  ?K0$   ?K0$   ?K0$   $00/K $000/K $000/K $000/K H2 0S$00 S$00SH2 0S$00 S$00S H2 0S$00S$00S 00 T2@0S$00 %  F0S3 ?K$  ?K0$   ?K0$   ?K0$   $00/K $000/K $000/K $000/K $0 $000C0S $0 1R$00S$0 H2 $00 T2@0S$00 4$  HFH2 H200C0SH2 1RH20S PV H2 H2 0S$00 SH2 0S$00SH2 0S$00 S 00 T2@0S$00 D#  F$00S $00S(0( <  < 00 T2@0S$00 "  E0S3 ?K$  ?K0$   ?K0$   ?K0$   $00/K $000/K $000/K $000/K $000 0S3 =K$  =K0$   =K0$   =K0$   $0 0 -K $0 00 -K $0 00 -K $0 00 -K $0 L2$ (0  (0$  (0( < @ < (0  (0 L : 0S 0H28 $040 :0SH22#H2"0S 7?O0K0TxIJ Pl0H- @MF@0 4 8 <0 0000 00$0 0 0$0 00 00 00 0,0 =0@0S ,04D0S*400, K$K  0: 0S. 00 0S, (0K4 < 0S(0 (0,  (0( < < (04 : 0S 0S00 0@0S0=0@0S , $08<04E 0S 0S00 00 ,0S $ ,004D:  7?OR00 0S$00 Sp !)('/7?HQZ $ ,004 h00 0@0Sa,0#  }DZ$ ,004*> Q$ ,004> H$ ,004q? ?$ ,0049 6$0 ,004G; ,$0 ,004A "$0 ,004l> $0 ,004:? 0@0S, $00H%D00  7?OR00 0S\00 0S 00 P,002 40 00ᄈ00 5/40$ 000 D 0S 0S00 0@0S0Q,00,0 40 ,0R*40X00S5 00048 <09@ 0S* 0S00  7?OR00 0@0S0!$0S 40$ 000 C 0S 0S00 0S0S 07?O K0سH-7?OY40 ,0K > 0S 0L,0S <0@0S 10 0>7?O;400 V; 0S 0/(0K4 t6 0S 0$(00S <0@0S00 0>7?O0 (0 00 0S(04 3$ $0S $00 0K$`H-MD@p t x |0 00 0(0 p000 t00  $ K p x02 0S 0 $0   ( K  0; 0SD0K v:`0K q:\0S |0@0S30>00 ` \0hK p3000S+ l0Kh K l0K0h K l0K0h K l0K0h K h0Kl K h0K0l K h0K0l K h0K0l K h0S t0 h0R *|0@0Sh0|"  =00 lh d0Kt 5 0S[d000Kd0t 2 0SQ0[S S#h0pt |0]; 0S'  7?OR?00 "h0pt |02 0S  7?OR/00 |0@0Sh 0[H~=7?O0 (D K`0K 03 0SF  6?OR 00 (0S (0:6 0S 0S 00 $0 E; 0S 0S 00 0S0S 07?OK蔿H-M  0 0S" 0(0S 0(0 C0( 0(02 0 00ᎁ0d0c0 0 0dS 0c0 x000 0x 00j; 0S20x0 0S000 $0H 0R*%0@0S| t005;7?O0  80S 803, ,0S 0S,00 40S 40 9, ,0S 0S,00 t0S 0t 00;, ,0S ,00 x0S 0x 00:, ,0S ,00 00 8, ,0S ,00 0 K0 DlxH-@M $ ( ,0 000 00 $(`:0S 0,000C Sn*fk4PI Q>,0 $ (01 Z,0 $ (08 P00 ,0 $ (04 D0000 00 $( ,09:0i,0000000 0 00 $( 0#60X$( 260R$( ,60L$( &60F0000 00 $( ,0209$( 60301 0S 0,0K$( 2 0S 0!0<0 0S 0000$00(0 0  086 0$ H/ 0S 0S0 0 0KH-MhE@p t x |0 0$0 p000 p0$0 0 @0K 96 50@0 0<0 p0 l0K E6 0So 03t00d K`K  0p/ 0S 0S\00 Z00 h00CS63@0K0 d h0`x| pth5 0S 0S00 d `0x|ptX9 0S 0S 00 t0` p00 9 0S 0S00 $Kd Kh0Kt]0 0S  6?OR00 0S 0S00 $032 0S 0S00 0$0 nt00d K`K  0. 0S 0SZ00 Xh0S>d \0KlKpt- 0S+t00S t00S@0K|   t  10 x0V9 0S\0K|   t  P10 x0D9 0S 0S00 t0` p00 8 0S 0S00 $Kd Kh0Kt/ 0S  6?OR00 0S 0S00 $01 0S 0S00 l0&60KԸܸ0H- 0Mß ( , 0 40 (000 , (02<S (020s0S 00@000 400  , 000R :0@0S300 40m8Z7?O400 001K, (02<S (020s0S 00@0400s ,0s00cs0![R![(00R0@0S1[4  (" 0 587?O~![ 00R*![ 0 0Sl 1[ 0[@PRS 0@0S1[4  ! 0  87?OT, ,(02<S (020s0S 00@040000 0 000S S S 000K 00K 0@0S000 4077?O![0[0 (00R 0@0SX000 4077?O0S ![0 0 K0舨 8lH-,M,B@ $ ( ,0 000 00 0K$( u/ 0S 0s000C S+(&%$#",0;SJ,0@0St10( s700 @,0;S; ,0@0S410( b700 /0<00S ,0@0S 0000( 00L7,0@0S00( B7 ,0@0S00  ( 5700 0$ b, 0S 00S7?O0K謤ȹ8d`tH-8M  $0 0$0 0 0S 0 0R*7?Oz00 KK  0, 0S 0h000C SLI4GFEDC.  0 g, 0S;  0 0 0S0 03 0S(0     $02 0S 00$  _2 0S7?O0 0 00 6 0S 0S00 0KH-HM0 4 8 <0 0 0000 00 00 00$00 0 0 0$0 00 0,0 400, K K 0+ 0S+ 0 04 0+ 0S 08  <    04 6 0S$0K4 . 0S$0<0 0S 0 $0S $04 X+ 0S 0S 00 0S 40 000%6 0S 0S 00 0 0 0S00S04000 0K0 0S~0004 0 0Su40 0K ** 0SP g400( K K 0i+ 0S! (004O+ 0S (004/ 0S  0<    04 80m 0S 0S 00 0S 40 0005 0S 0S 00 0 0  (0K. 0S 6?OR 0S 00 0S 0L. 0S 0S 00 0S 0 T3 0S 0S 00 0S 40 000Z5 0S 0S 00 0KH-Mh l p t0 h000 h0$00 00 0 0 0\0 l0h0 ,0K-/ 0S 000Kp ph02<S h020s0S 00@0[00000 p ph02<S h020s0S "00B0[0000 0 000S$0$0 $0 L0K\Khl( 0S 7?O0 dH0 \0K m3 0Sb\ H00 000S000 \0K U3 0SL\0 00 )\ 000 00S 7?O0 * 00T K )000S+ `0KT K `0K0T K `0K0T K `0K0T K T0K` K T0K0` K T0K0` K T0K0` K l0 T0R:l00T KPK 0) 0S 00 P T0hl) 0S 00 l0P h00A4P00S S+P0 T0hl1 0S# 00 l0P h00%4P0 T0hl* 0S 00 l0P h0047?O0 l0P h004 0S 00 ~\0T tl h 0/ 0SyT0,  hl 0 0S 00 ],l0 00K ( 0S2 bl00X KPK 0F) 0S 00 X P0thl3 0S 00 l0P h003 0S 00 0 X0K, 0S 6?OR00S, 0Stu* 0S0[00Kp01 [RG: \0S \00,0 A1( (0S (0 0 p00l0( (0S (00S 0 0KH-(M  $0 0$0 0 00 KK  0( 0S 0+00S S0  $0g* 0  $0) 7?O0 0 00 2 0S 00KH- M  8 0 .00 #00  0.0S0K K  0G-0S0S 0[S 0[ S 00000 0S 00 0 1R:KH-@M $ ( ,0 00 00 00 0 0 0K\ + 0S 0K  - 0S 0S+ 0S| 0(( 0Sv 00S 0?+ 0Sl 0     -  $ 0*) 0SZ0K  Y- 0SS0(' 0SM 00S 0+ 0SC0     -  $ 0( 0S10K $( ), 0S*0  0  0  0  0  0$   ,0 0,  0S 0 /0S 0 /0S 0 N/0KH-M  00 00 & 0S 0S 00 00S00S 00   00  /000 0S0 0 / 0S 00 00 / 0S 0S 00 00 u/ 0S 0S 00 0T0S 0T0..0KH-`MP T X P00L0 L0 T0Rf L0@0L0 L0SP0 00 00 0 ,0K -H0K -00000 T0K,0 0(0 P0 ,0KHK . 0SH0L0 L0P  @ @0S P00L @ D L P0 L0P  D % 6?OR 0&L0K  0S 0L0P  @ @0S P00L @ D L P0 L0P  D L0H  H L X0 0KH-`MP T X X0H0 CX0H X0H0S 0KT0 0 0 ,0K -H0K -X00,0 0(0 X0H0 L0D0 T0 ,0KHK  S& 0S 0$T000  X0R 0@00 0S0S 0@0S 0@0 D D 0D0 @ Ph/0KH-0M   0 0K + 0S 04 0 & 0S#00S 03) 0S 0     -   0' 0S 0  0 4.0KH-XMH L P T0 $0K q,@0K l,P0K$0 0 0 D0K@0 080 (0<(0 $0K@ K  HL - 0S  6?OR0D0 0D T0 0KH-XMH L P $0K 8,@0K 3,0D0 P0K$0 0 0 D0K@0 080 (0<(0 $0K@ K  HL - 0S  6?OR 00<0 D00D0 $0K@ K  HL b%0KH-HMH L $0K +@0K +(0>(0 0< 0 D0K$0 00 $ K@0KH 0% 0S 0D L0 0KH- M  000 0 0K # 0S 0 0KH-`MP T X P00 0 ,0K +H0K +T0K,0 0(0 0KP# 0S 0QT L0K . L0 X00R L0@ 0S0- 0S 000. L0K'$ 0S  6?OR 0-00- 0S 0X0  X0H0 0D0 P0 ,0KHK  $0KH-@M@ D 0K 7+<0K 2+D00 D0 D0<0 080 K<0K@ 0,0KH-PMH L P $0K +@0K +L0K$0 0 0 $ K@0KH 0$ 0S 0@0 P0 0KH-HMH L $0K *@0K *$ K@0KH 0$ 0S 0@0 L0 0KH-M e'0KH-M  0KL 4, 0S 0 0L * 0 0KH-(M 0K g) 0S 0+ 0# 0S 00  0% 0S 0 0 0 $,0KH-M 00 ,KH-`MP T X \0 P00 0 (0K R*D0K M*T00S1P00  T0E" 0S& 05D0H K J#0S H0S T00) 0S 0H0S (0 X0 D0 \0 T0( KD0K 0# 0S 0KH-XMP T P000 (0K )D0K )0H0 H0KD0 0<0 <,0 T0K(0 0$0 P0 (0KDK R+ 0SH0S6?O 0 6?OR 00KH-XMP T 0H0 P000 (0K )D0K )0L0 L0KD0 0<0 <,0 T0K(0 0$0 T0P, 0S 6?OR 07?O0@0 H0KD0 P0 (0KDK "0KH-XMH L P H000 (0K n)D0K i)L0K(0 0$0 P0KD0 0@0 H0 (0KDK " 6?OR 00KH- M    0 0S% 0X00S 0000 000 000 0) 0X0 0X 0X0 0X 0X00s0S 0 0 0000  0I%0KyH-4MTF@( , 0 40 (000 00 $0K,4 $ 0S 0}$0<0@0S00 (, 40! 0S  7?OR>00 00L0S (0 (02<S (020s0S 00@0 c00L00p0s0 0Cs001K00L0S(0 (02<S (020s0S 00@00c#1s0 0Cs0![R$0 ( 00 0@0S 00L0h$ 4 9,$00 L ( $00 T $00 P $ $0  00X0S 00X 40R 00X ,0 0R40S00X0S 00 0@0S 00X0# 4 ,$00 X  00000S $0$ < +< 0000 0S 00000s0S 40S 00 0@0S204 +$0$ < < 00000s0S $0$ <  < 0000@0S $0$ <  < 00000S $0$ <  < $0<00S $0<00S 0@0S 204 +00 00000S $0$ < ,< (0 $0<0;S 00 0@0S104 +$0<0<S $0<00S 0@0ST104 o+00 00000S $0$ < ,< $0$0S 00 0@0S $0$0  4 P+$0, 0S 0S 00 0@0S ,4 ( 0S 0S 00 0S0S 07?OKx(t,H-DMDC@8 < @ D0 800$0 00 00K<D " 0S 0@00S $20c' 008<@ D0s# 0S  7?OR00 0000008<@ D0 0Su00<00S 0@0S$ 20D *7?O0 c00 00KN@ @802<S 8020s0S 00@0[0000(0 (00s0s0S)(00S(00 0 (00S(00 0 00 0@0S0[$! D *0S 00   0R 00 0[00K@01 [R:00 $ 00@ ! 00$< , ,0S 0S,00 0S0S 07?OKprdtH-DM C@( , 0 40 (000 00 0K,4 " 0S 0000 S #800S 00(,0 40" 0S \20w& v 7?ORl00 000S 000S00 0 000S0010s00010000S  00000(,0 40g 0SE 00000(,0 40 0S  7?OR/00 0@0S,104 )%00S!,004      (, 00#! 0S  7?OR00  0,  0S 0S00 0S0S 07?OKo̼H-lME@` d h l0 `00(0 00 T0K %0 0 0\0 X0Kdl 8! 0S 0&h00S (40% `000 `0 \0K( % 0S\ `00 %h `02<S `020s0S 00@00,0 00 , 0 h00R:0@0S(30l 0 )7?O0 00, 0000 , 00 h00c 00R*`00 C00R*00 0@0SV00(20l 00(M0 0R*000 00 0 h h`02<S `020s0S 00@0000040 \ 0000S\ 000 400T0 0P0 400L0 T0Kdl  0S U0@0S(10l 00(00 000 h01 0Rk\ 00$0 $00S 0@0S$ \00c(H! l t(00 $00$0 \ `00 $0R0s h01R 0@0S h01  (  l T(00 0s 0 X0(d 8 80S 0S800 \0S \0(%0S0S 07?OKk4\ȽH-|M K@p t x |0 p0040 0,0 ,0$0 0 0 \0K X$d0Kt| 0 00S 00x00 S #h00S 0@0S4l:0X$0 sp00h0 p0 `0K4 0 00Sa00 0000h0K0l0K 0px| 00 0 Z7?OR R 7?OR0$0 y0$0 @x xp02<S p020s0S 00@0000080 ` l0100S` l010 &` l0100S00Sx00S d0d <  < 00 0 0,0 0$0 0@0S4`80| 0h'8000S S" S,x00S 8000s0 ?0l 00C0 8000s0 ?0l 00C0 d0d <  < x00S0 0l 00C0 l000 ,0S ` 0100S 0@0S4$70| 0'0$0 ` 0100S` 010 0,0 800s0s0Sx00S 0$0 0@0S460| 0&8000S S& S x00S 0$0 0@0S460| 0&x00S 0$0 0@0S~450| 0&x00S80 080<0 8000S<0 p00t R0$0 0@0S[<00  48% | &W<0 t0 0R<0 |0R <00S0$0 0@0S=<000440| 0{&7<00\0 8000S00X0 <00P0 \0Kt| 0 00S 0$0 0@0S80000440| 0P& 000 x01 0R`0(0 h00 (0Sm` 0100S5 S:ST 000`p 0 0PpQp0$0 0@0S 430| 0 &000 ` 00100SW0 p00R:W000`p 0 0PQ 0$0 0@0S4@20| 0%0(0 00 0 40$0 0@0S)410| 0%&` 0100S S:S0(0 0$0 0@0S410| 0% 000 p0 0R_`04#h0s x01R 0@0S x01h  4  | |%0$0 0S 0s 0 d04t @ @0S 00S@000 $0S00S 007?OKЈf(LԾ(PpȽH-M4H@  0 0S 0K $ $0S $001000 0040 0 0 0$0 00 x0K j!`0@0`0 0K b!|0@0|0 000 00,0 00S 00@7080 00 S80(0 70(0 0$1S 0$1<0 <0 0S <0 0(0 x0K0 0K0 02<S 020s0S 00@00@0 00S00D0 00S001Ka0H0 00 H00 ,0L0 00,0 L000 00S/ S- SW 02<S 020s0S 00@0[0000P0 P000SP0 00 <P0 0 P00 0 c 02<S 020s0S 00@0[0000T0 T000ST00 T0 0 T00 0 7440 $ 0S0 < @ < 00  0 00 0000 0 0$ $0S 0 0 0@0S$0![ 4#  &$0000 00S 00S 1[0@ 0 [D00c0@00R (0 3/00X0 X0S 0 0 0@0S1[4#  #X0S1[0@ 0 [D00c0@00R 0@0S1[4"  #0 0 0S 0 <  < 0S 0 0 0@0S4<20 #00SN1[ 0s0RG1[0C K K  h $ $0SA1[0 K K  X $ $0S10S 0S0 < @ < %K K803/0S0 <  < 0S 04\"0S 04U"D0s 1[01K![0R:0S 04 \ \0S $0S\0$0 ,0S 4,3"00S 40-"$0S 0S $07?OK([l8H-\MxD@@ D H L0 @000 0,0 ,0(0 D000 (0KDH  0S 0D0 00KH A# 0S00S L0@0S30H "7?O0 D00H  0S(00 0 0S L0@0SP30H "7?O0 ,0KD   0S,000C S~31yxwvufL090 (0<00S 0<0 (0<00S 0;0 (0<00S 0:0 0000000 000@D 0e" _L0*;0 (0$0S 090 000080K040K 0<0K0@D 0J" 0SA(0$0S <0S (0$ <0R L0@0S<0`! H _"7?O0 '00 $L0@0S 10H N"7?O0 L0@0S,00  H >"7?O0 (0S (0D c$ $0S 0S$00 ,0S ,0D R$ $0S 0S$00 0KRt4H-MN@  0 0S 0 0S 0 00<0 0$0@0 0`0 00 00 00 0(0 0)0K080 8040 0@0S` h0K 8 80S 800\0 h00$0 09S00D0 090D0S 0,00 0000 040)0K0 , 0, 00 0 4 h00 Sj #`00S0SX`040Sh0 04 h00SJ 8h0 040R 040 0@0S h0 h004<s!0X00S-h0 000R 040 0@0S 0, 000h<DW!h0 0,0R 040 0@0S h0 h00,<@!h0 0, h0 00 0X0 0X \0K8 80S\ d0K 8 d00Sd0 d0 0L8 80S 8 7?OR040 \ d0K 8 80S \08 80S0\0 h00S0;Su0<S 0;So 040 0@0S0<`*  0;S 040 0@0S}0<*  h00 SM h0<00SJ 0<S 040 0@0SB0<)  A\0KA8 80S\ d0K : 8 70" h00S: `0S00 K`K@ 0F8 80S0<S 000$1 000 00S2000 0` 008 80S 8 7?OR040 0:S h0 0R D0S 040 0@0S 0h  <P#  0\ 0S 0$  0S 0  00T0 0 x0KT}8 80SMx0S 040 0@0S0<#  3 0 0T 8 80S3D0S1 000S- 040 0@0S'0,0<t$   D0S 0 0 0 , 0) [4 `0S 0 `0@ 0X X0S 80SX080 h0< X X0S 80SX080 \0S \0X X0S 80SX080 80S40S 807?OKH-TMDD@@ D H L0 @000 80K  00 0 00 H01S0H00S S S H010C0K H010C0K300L0So H00Sk L00SL0 080 L0040 "L00SL0 00 00 80K  @D  0S 020080KH     < K @D 7 0S<0S 0@0SH00D"  7?O0 0@0SH00"  8 L0 0R 800S 0j0Sf 00S0 080 0040 "00S0 00 00 80K  @D s 0S 0@10;09 [80KH   < K @D  0S<0S 0@0SH00   7?O0 0@0SH00T   8 0 0R 800K8PH-MJ@  0 00 0 00 00  02<S 020s0S 00@00$0 X0K @0@0 t0K 0K :00 00 0K 900 00 0 0K   0S+00s0S 0 0K  * 0S000 00K01K00S01 [R*0[   K   0S5 0S!0[0s0S ![0[0CR0K   80 0C( (0S 0S(00  Z7?OR01 [R*0S7?O0  02<S 020s0S 00@0[0000,0 00S,00s0s0S0S!0[0s0S ![0[0CR 0K   $70 0 0S 0S00 0[1K0S 0[S08S 00000060 0 0S 0Sj00 p0[0$ 001K1[2K,000S Ss SE 0S 2[ 01K0S ,040 40 0 0R0[0s0S0K   50 0 0S 0S,00 040 0X0K I 0S 0S00 0S ,0 2[0s00s00s00C1K,00X0 ,00T0 X0K   40 0D 0S 0S00 0S 2[ 01K,040 0S0080 [800CRھ0[8^0S0[0$ 0 [800c0$00RXKtKJ0S,0 00<0 <[0StX0K K   <   0Si 0Sh00 j40 X0KK  0S 0S00 0[0s0ST t0K  ( 0SxtX T0 T0p0 0SX0K0K   ,20 0 0S% 0S$00 " 10 0SK00 I 00s0S 0S 2[10 1[10 0[00K 0S 0 r0S 0 kt0S t0 d 0S 0S00 0K44H- 00S 00H0S 00H0 2S 000 0S 000 0S0000 $( ,0 0S  0S 0S00 0S 0  0K!@H- M   0 0 0K  0S  0    0x 0KpH-lM O@` d h l0 `001 0S 0`0000 00 040 0\0 40D0S400S 00 400s0S 7?O0 0 0$0 H 02l 00 S  7<HFCh00h0 `00S `00L0@0S 02l 0   02l 0 0 "l  "l  "l   0dh $ 0dh $  02l 0 \0K` h0$ d0S 0(0 0,0 02l 00S0,0  02l 00 S d0X00s0S 0(0 0,0 02l 0 080 80S d0 010b1 80 80 80` $ $0S b80 800 8000 00 d0@0s d0@0 d0@0000  0$00T0 00s 00 00<0 ,0S 0 0S 0 0S00s 00 0    b  000       000  0$00T0 T00@0 40D0S& 004P40D0@ Y0, 00S 00P004`40D0@ Y0, 00K0S 7?On0,0Sd00 Cd0 0 0S 0 0S 0 0S 0 0Sd00 Cd0 T000 8^$ 40D0S& 004P40D0@ RY0, 00S 00P004`40D0@ AY0, 00 0S 7?O$0S 80S T0 T0 0 0 T0 0 000 <00 0S"$0S e80S d00`8 $ $0S W 02l 00SP S SL L(0S Gd0@0s d0@0 d0@0000 60 0S&0000@0S 0 0000cP0 00H0 d0X0 d0X h00  P K 0d 0x $ $0S 00s 00 000 0SI 02l 0 0$ 40@0X0@0 40D0S& 004P40D0@ X0, 00S 00P004`40D0@ X0, 0080S 7?O[ 02l 0 0T K 0@ 0j$ $0ST0S/$0S0$0 40D0S 004P40D0@ MX0, 00S 00P004`40D0@  00S 00H0S 00H0 2S 000 0S  000 0S0000 $( ,0 0S 9  0S 0S00 0S 0  0KpH-0M  $0 0 0 00 0 0 0D0S 00S 00 00"0S 7?ON 00S 000S 7?O?0 0K + 00S 000S 7?O(0S0 0 $0  0D0S 00S 00 00g0S 7?O0KH-(M   0 000 00S 00L0@0S 0 0<0 0D0S0 00S 0 0 000S 7?O$000000 0 0 0D0S0 00S 0 0 000S 7?O 0KH-$MD@( , (0 0 0 0D0S  00 00 (04 ,0,00 00S (0 000S 7?O(04 0D0,00 0,00 c00S (0 0000S 7?O00s 00 00000 0S. 0 0s 0 0 0    b   000      0 000c 0  000 00S (0 00s0S 7?O0,00 0S 0R:0Sf (04 ,0,00 00S (0 00 0S 7?Og00s 0 0000c 0 00 00 0 0s 0 0 0c00 0 0 00 c0 0  00 c0 00 0 c0 0$0 0$ 00S (0 000S 7?O00S 00 (0400 (04 ,0,00 (0000} 0K$ pH-dMO@` d h l0 `0080 `0 0<0 8001 0S 0d0S8\?000,0 ,0(0 00 0L0 <0t0 0R8 ?0 0l0SB`000@0S 00`00 0000  0$00L0 L00 0 <0D0So `04P<0D0 (T0, 00S` `0P`04`<0D0 T0, 00 0SK 7?O[l <0@0T0 0 <0D0S( `04P 0 <0D0S0, 00S `0P`04` 0 <0D0S0, 00 0S 7?O" 00 0 00L K `l 0 , ,0Sh00S `08 040   h00S`08 040  0X0 0$0 000 h00S 00 L0(0s L0(0 L0(0000 `000@0S d0d `000c@0 a0 @0R+0 0R#0,0Sh00S00 0 `000@0S 0 `000c 00 0 0 0 d0X0 %00`d g0S 0X0 `00 0 0<t0000S0 0S 0 0S0$0 0000 0 0s 0 0 000 0S0S X0Sh00S0S040 v040 sh00S 040 lh00S 040 eX0S 040 _L0 0s L0 0 L0 0000 `00 0 0<t0000S 0 @0R0 0s 0 0 000 0S0S040 )$0S 0SL0 0s L0 0 L0 0000 0 0S0 00R040 040 0S040 040 40So8<0D0 R0D0 `04 D0,00s `04 D0,00 `04D0,00000 0S`D, ,0S e0 0s 0 0 0    b   000      `04 D0,0 ` 4D ,P  b   000 `08 040    `08 0400R `08 040` 8 4   `04 D0,0    `04D0,00R `04 D0,0` 4D ,   00S08 = , ,0S00S 008 0S 7?O`000@0S d0d `000c 00  0 L0 00c 0$ L0 0( d00Sd0$0s d0$0 d0$00S d0@0s d0@0 d0@00S00(0 d0@0s d0@ d0@000c 0 d0@0 d0@0 00s 000c000   d0@0 cd0@ d0@0 0 c0 5`000@0S 00`00 0000 0S 0S 0S 0S0 0S 0 0S 0 0S 0 0S d00 d0 0 040S񏐴3210 , 0 L0(0 0 cL0,0 0 L0,0SL0L (  b( L0( L0,00L , bL ( b L0  L (  b, }h00s0S 6?O,0 <00 <0 L0 0s L0 0 L0 0000 0SY<00S <008z 0S 7?O<00s L0< <  L  b  <00 <00 L00s L000c00L00 <00 c<0 L0  L0 <00 c<0 L0<  L  b <00S <0080S 7?O40S; Sp SL0 0s L0 L0 000c 0 L0 0 L0 0 0 0s 0 0 0c00 L0  L   b$ 0 L0L   b L0 0 0 c0 e0 0s 0 00c 0 0 0  0 0s 0 0 0c00 0 L0  L   b$  0 c0 0 0s 0 0 0c0 0.0 L0 0 0 cL0$0 0 L0$0SL0L   b L0 L0$00L $ bL  b L0  L   b$ d0D d0L08 I0S 0 , d0d D0L h00S d0X00S d0T00<04000S d0D08 d0 H d0H d0D d0L0Sd0P0S 0S d0D d0L08 0S d0d D0L d0D0Sd0H0S <0 0S<00S <0 d0D0R<0 d0H0R <0 d0D0R<0d  0D 0 , `08 040  <0  <0D0S( `04PL0 <0D0,O0, 00S `0P`04`L0 <0D0O0, 00f0S 7?O^h00S= X0K8  50, ,0S3 <0D0S( `04@L0 <0D0N0, 00S `0@`04PL0 <0D0N0, 000S 7?O#L0` 0I<0D0S<00S `0 <000S 7?O<00S (0S<0 T0K8 0P0 8080SH P0K8 +, ,0S? <0D0S<00S `0 <00J0S 7?O<0D0S `04@<0D0 wN0, 00Sy `0@`04P<0D0 fN0, 000Sf 7?O00S 0080S 7?OP0S P0  <0D0S<00S `0 <000S 7?O<0D0S& `04P<0D0 "N0, 00S `0P`04`<0D0 N0, 000S 7?OU0,0S d0 H d0H d0D 0,0S SG S6?O,0 ` 7, 00 ,0Sd0D d0L0Rd0H d0P0R00s0d0D d0L0R00s0S `08 040,  , `08 040(  ( 6?O,0 d0 H d0H d0D h00S2 0 0s 0 0 0    b   000      L0 L ( b ,  000 0  "0 , 0,08,  8, p`000@0S 0 `000c 00 0 0 0 d00 d0 0 0S 0 0S 0 0S 0 0S d00 d0 0 0Sd0X0 d0X <0D0S& `04@<0D0 M0, 00S `0@`04P<0D0  M0, 00X0S 7?OP0Nh00S 0 0S `d 7H H0S ,0SH0,0 <0D0S& `04@<0D0 L0, 00S `0@`04P<0D0 L0, 000S 7?O,0KpH- M10 $   R !0@ 0a 0S 00S 0000S 0010S w0J 080S00 0K   0S 08 00S 00H0S 00H0 2S 000 0S 000 0S $L 0S  0S 0S00 0S 0  0K H-M  00S 00L0@0S 0G000 0 0D0S0 00S 0 0 000S 7?O,0K 0) 0 0D0S0 00S 0 0 00<0S 7?O 0S 0S 0 00 ' 0K0H- MŸ $ ( ,0 001 0S 0 000 0 00 000@0S $0000 $0000 $0 00R 420,20 $0 0~0D0S( 04@$0 0D0K0, 00S 0@04P$0 0D0xK0, 0010S 7?OQ$0 ,07b 0D0S( 04@$0 0D0UK0, 00S 0@04P$0 0D0CK0, 000S 7?O$0 (0 0S00S 00S0 0S00S (0 0 K00H- (M(D@( , 0 40 00 (001 0S 0(000 0 00 0D0S00S 0 000S 7?O000@0S ,0000 ,0000 ,0 00R ($3030 00 000@0S 0000 000 0 0 0S 0 0S 0 0S 0 0S00S 00S 00S 00S 00 C 0 00  ,00   0$00$0 0D0S( 04@$0 0D0zJ0, 00S 0@04P$0 0D0hJ0, 00!0S 7?OS08 $0040  405$  0D0S( 04@$0 0D00K0 0 00> K >0K  1 00 0 010b1$ 00s04KH000S @0K0 0 00@ K @0K   00 0 010b1$ 0 010b1$ 00  010b1$ 0000 0 0 010b1$ 00,0 000 2 010b1$ 00,0 ,00D0 H000SD0K0 0 00D K 00D K 00D K D0K  00 0 000 010b1$ 0 0 0R*0 0 P0RH:L00H0 L0 L0  0K[0H- xMh l p t0 00S000 0`0 h000 000 000@P 0 0PQ 0 `0Kh ] 0S 0`0 00 L`00 0 0 0 0D0S 00S 0 00?0S 7?Oh000S\0K  \0K0  \0K0  \0K0  \0K 000 00 h000S V0K  V0K0  V0K 000 h000S X0K  X0K0  X0K 000 0$0 $00(0 0D0 5[@0 5[00 00 D0Kt   T K lp  0S $0(  :5[S# h000S$0  $00  $00  $00  $0 000 5[S  r 0Cs05KR$0(  000 \0 Rr: 0D0S 00S 0 00 0S 7?O`0S `0h~0 K0H-M  00 0 0 00S 00S 0 00R 0 00R000.0, 00S 0&000 000 0 00R 0 00R 0 00R0000 00 0KH-\M\D@X \ \00S  \000 X000S,0K  ,0K0  ,0K0  ,0K0  ,0K 000 00 X000S &0K  &0K0  &0K 000 X000S (0K  (0K0  (0K 000 00 00 0 0 K40KX  =00S40S20 00 000 000  00S 40S 20 004PKP0K0 00S 000 400 102[00 00 X000S$0K  $0K0  $0K0  $0K0  0$ K 210 $0T2[S# X000S$0K  $0K0  $0K0  $0K0  $0K 000 2[S  r 0Cs02KR 000 ,0 R:KLH-M 0/ 0/ 0/  0S 01000 00KH-M 000 00S 000 KH-M10          R   R 0@ A0"00S 0S 00 0 0S 0 0t 0 0S 0 0 0S 0 0 0KLGH-M00        R  0 0(00S 00h0 0  00 A 0S 0 0 0 00  0K0FH-M20       R   R!0@ 0f00S] 00 0 0S 00S 0000S 0010S.0H080S00 0K  0S 0600 00S 00 000S 7?O# 0 0 0 00 00S 00 00Q0S 7?O 0S 0  0 0 0KE0H-$MB@( , (000 00 0S 00SX20@ 10,00CS00 00S}200z0S 00S 0000S 0010S0c080S0$0 $0K % 0S 0Q000 0 0 0 00 00S 00 00>0S 7?O8 00S ,0S 0 ,0R 0000  00S 0,  00 00S 00 000S 7?O $0S $0  (0,  0KBH`H-M00       R   Rd 0@ 000S 00 0d 0 0 0 0K@@H-Md00       R 4 0 00  0K?H-M00       R   Rd 0@ 2000S 00 0h 0 0 0 0K?H-Md00       R 4 0 00  0K@>0H-M00       R   Rd 0@ 000S 00 0l 0 0 0 0K=LH-Md00       R 4 0 o00  0K=hH-M00       R   Rd 0@ 000S 00 0p 0 0 0 0K<H-Md00       R 4 0 00  0K;H-,MB@( , 0 (000 00 0S 00Sh20@ A000 00Sm 000 0 00 0S 00S 0000S 0010S0m080S0$0 $0K ; 0S 0[00 00S 00 00Z0S 7?OH00S S 04 ,0 08 ,0 00 00 00S 00 000S 7?O#$0S $0  00S S (0 ,0 (0 ,0 00 0S (00 u 0K@;H-,MB@( , 0 (000 00 0S 00SX20@ 000 00Sk 000 0 00 0S 00S 0000S 0010S0i080S0$0 $0K 0S 0W00 00S 00 000S 7?OD00S S0, 4 0, 8 00 00 00S 00 000S 7?O!$0S $0  00S S(0,  (0,  00 0S (00  0Kt8H-$M@E@( , (000 00 $0K(D  0S 0:$0(  $0(  $0  $0 $0 , ,0S $0$ ,  , 0 00R*0 0 0 00R*0 0 ( $00( ? 0S$0,00s0S $0( 0S$0$  @ R $   $ $    0 0 $ $000@0S 0H0$00 0H0000$ $000@0S 0L0$00 0L00<0$ $000@0S 0T0$00 0T0080$ $000@0S 0P0$00 0P0040$ $000@0S 0X0$00 0X00@0$ (0 (00 00S (00 00(0S 7?Ou00 00S 00S 00S 0 00R (1000 1 00S0 0 00S 0 04 00S 0 08 (00 00S (00 00(0S 7?O.00 0*(0 $00S 0S (00 00S (00 00(0S 7?O $00( $0(0K5H-LMDM@P T P0000 T0 T0 0A , ,0ST0 T000@0S T0 0T0 0T000c0T0 040 4A/40P t, ,0S ,0000SP000s0S 0(0 <<00 0(0 (<00 000(0 0000 40  40  40 40 40  00 404 00 408 000- 40< 000& 40@ 00 40D 40\0 _40 \ 40!` 00 40d 00 40h 00 40l 00 40p 40( t T0(0(  H0K d, ,0SRH (0( ET000@0S H0H0 T000c4 H0T040@0!H0K ?, ,0S/H 40@0T000@0S H0H0 T000c4 L0T040@04 H0K , ,0S H 40@04 T000@0S H0H0 T000c4 T0T040D0, D0K , ,0SD 40D0, T000@0S D0D0 T000c4 P000 D 0,0P i, ,0S ,0 000 40D 0R400P U, ,0S ,0400P I, ,0S ,0T040<0!H0K , ,0SH 40<0(T000@0S H0H0 T000c4 X040  40 40d 40D000 40l 40D000 0 0 8D  0,0  D  0,0  40d 40D0\0$0 0S $00$0 00C0 00 vT0 80K0 >, ,0S680 80  80 , D  0,00s* 80D , D ,  8  b D  0,00 D 0,00 80 0s 80 0 0c00D  0,08  D ,   b 80 D  0,08 D ,   b 80D ,  8  b 000  $0R:40l 40D00$0 0S $00$0 00C0 D  0,0 D  0,0  00 pT0 @0KL , ,0SD  0,0 0s* @0D , D , @  b  D  0,0 0 D 0,0 0 @00s @000c00D  0,0@  D ,  b @0  D  0,0@ D ,  b @0D , @  b @0  000  $0R: 00 0 40D 0R40 , 40 0 40 $ 40 ( 00 \T0 <0K` , ,0S  P,10,0@40$0s <04 $4 $ <  b 0 40$0 40$0 <000s <00000c040 <000 40$0 c40( <0 0 <0 40$0 c40$ <04 $ <  b4 000 40h 0R0K\0hH-(M( (00 0 000 000 (00@0S[ 000@0S 0H00 0H00000@0S 0L00 0L00000@0S 0X00 0X00n000@0S 0T00 0T00]00 0 0s 0 0 0    b   000       04 0,0  4 ,  b   000  04 0,00s 04 0,00 040,00000 0S;00s 00 0    b   000       04 0,0  4 , b   000  04 0,0 0s 04 0,0 0 040,0 0000 0S000 0D 0R{000@0S 0P00 0P001 000s 000 0 4   0  b 4  0400  4   0   04 0$00c 0(  0400  U0$0s 0$0 0$000 0 0S( $ ( D(0 $0K-M 000 0 0000Ћ/H-M 000 0 0 AH0 0 0 00  =0 0 0 000110 0 0 0001%0 0 0 00~04 0 0 0 00, 0 0 0 00   0 0 L0   0 0 `0   0 0 0020 0 0 0#1 0 0 0KH-(M20 $ (   R !0@ /0o !0( 0 0S 0b 0S 00S 0000S 0010S 0K 080S00 0K  ( 0S 09 00S 00H0S 00H0 2S 000 0S 000 0S $(  0S  0S 0S00 0S 0  0KH-M  ! 1 10 0 0K ^ 0S 0y10 00S 10 000S 7?Of 0 00  0\0 0 4 h 0 8 p 00 0 L 8 4  L 0 P 8 4   P 0 T 8 4   T 0 X 8 4  X 0 \ 8 4  \ 0 ` 8 4 $  ` 0 l 8 4 (  l 0 t 8 4 ,  t 0( 080400R*0 8 4  ( 0@ 080400R*0 8 4  @ 0 0804000R*0 8 4 0 10s0S9 08 040K00 08 0404 08 040  08 040  08 040  08 040  000 0@ 0R00 0   4 ,   0 $ 4 ,   $ 0 8 4 ,   8 0 < 4 ,  < 0 , 4 , $  , 00 040,0$0R*0 4 , $ 0 0 D 4 , (  D 0H 040,0(0R*0 4 , ( H 04 0,0.KE?K00 |! | 0 x! x 0 1R*0! 0! 10s0S6 04 0,0CK 04 0,00 % 04 0,0 ! 04 0,0 ! 04 0,0! 04 0,0! 000 0D 0R)00 0000 0000 000  10s0S\ 0K\ 0 0\0 10S#00000000 04 0,00000 0D 0R 0\ 0` 0d 0h 0l 0 0 0| 0 0 0x 0 0 0 0t 10 00S 10 00!0S 7?O 1 0KH- M 20 $   R !0@ 0n !0$ ?0 0S 0a 0S 00S 0000S 0010S 0J 080S00 0K   0S 08 00S 00H0S 00H0 2S 000 0S 000 0S $H 0S  0S 0S00 0S 0  0KdH-M  00 000 0S 00S  0S 0S 0 0>0S ^ 0S 00KH-MH@ $ 0K $  0S 0$00S X8000 @(  00 $(  00 (  00 '  0 0 '  00 '  00 '  0 0 |'  0$0 `'  0(0 D'  0,0 ('  000  '  00 &  040 &  080 &  0<0 &  0@0 &  0D0 d&  0H0 H&  |0L0 ,&  t0P0 &  l0T0 %  d0X0 %  \0\0 %  T0`0 %  L0d0 %  D0h0 h%  <0l0 L%  40p0 0%  ,0t0 %  $000 40 0+0xP0x 0|00S" 0x0 0 1Y8 0`p0x 0|00 0 0e00  $  A0P0 000S" 00 0 1Y8 0`p0 000 0i 0000 P#  0P0 000S" 00q 0 1Y8 0`p0 000^ 04 000 "  0P0 000S" 00< 0 1Y8t 0`p0 000) 0 000 !  0P0 000S" 00 0 1Y8? 0`p0 000 0 000    m00    0 0K 4Px$ 3D#9 0 > 3D!#9@" @0c/0 0 0 0 0 0 0 0 9 ;CR 00 0 0 6 3D#9! d$00(0 ( 6 0@R10 (0U ( > 3D#9t! J$0 $000S" $00 0 1Y80 0`p$0 $000 0 000  $0 00S 0@$0$0 KT00@0 0S @ <00c0 却@0 0 000S`0K0 0 00` K 00` K 00` K `0K  〭 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  \ 00 0 000SD00 0 00D  00D  00D  D0  8000S 00D   00D   00D   00D   0 D00  00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  㘬 00 0 I000S000 0 00   00   00  00  n 00 0 0 00  c000S00 h  0 0S 000 0 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S h 孰0S000 0S 0000S 00 0 00  00  00  0  000S 00   00   00   00  0 00 ǫ  㬲 00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0ᐳ0KH- M  0K g 0S 0q0 0 0 P  00 =000S0  00  00  00  0  2 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  ۪000S0 0  0 00  0 00  0 00  0 00 㲪 00 0 000S0K  0K0  0K0  0K0  0K  ㎪0  00 0 00 l000S00  000  000  000  00  \ 00 0 0  00 0 0 000 5000S040  0400  0400  0400  040  % 00 0 0 0 040 0 0 000S0L0  0L00  0L00  0L00  0L0  00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0X0 00 00 l00S d0S0d0S000 00 d0S0\0 D0K<0 0@0 @0D0 ;d0@0S X0`d 孮 0S 0hd0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0\0 0S 00  0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` Q 0S 040 L0K` D 0S 0L0080 0S 8 400c0 80 0 `000SX0K0 0 00X K 00X K 00X K X0K  00 0 `000S\0K0 0 00\ K 00\ K 00\ K \0K  00 0 `000S<00 0 00<  00<  00<  <0  ¨`000S 00<   00<   00<   00<   0 <00 㙨 00 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K  s 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  J 00 0 5`000S000 0 00   00   00  00  00 0 0 00  00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S 000 0 00   00   00   00  00 0 0 00  ᵧ 00 0 0 `000S00 0 00  00  00 0  ㏧ 00 0 0Sd0SHl008 K`卯 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`]0KH- M  0K 4 0S 0X0 0 0 d  00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  Ѧ 00 0 000S00  000  000  000  00  㨦000S0 0  0 00  0 00  0 00  0 00  00 0 00 `000S00  000  000  000  00  P 00 0 0  00 0 0 0,0 )000S000  0000  0000  0000  000   00 0 0 , 000 0 0 0H0 000S0L0  0L00  0L00  0L00  0L0  00 0 0 H 0L0 0 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0d0S000 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d 哪 0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 00  0S 000 0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` / 0S 040 L0K` " 0S 0L0080 0S 8 400c0 80 0 `000ST0K0 0 00T K 00T K 00T K T0K  00 0 `000SX0K0 0 00X K 00X K 00X K X0K  Ĥ 00 0 `000S<00 0 00<  00<  00<  <0  㠤`000S 00<   00<   00<   00<   0 <00 w 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  N 00 0 5`000S000 0 00   00   00  00  $ 00 0 0 00  00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S000 0 00   00   00  00  ģ 00 0 0 00  ṣ00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  ㎣ 00 0 5`000S 000 0 00   00   00   00  d 00 0 0 00  Y 00 0 0 0Sd0SHl008 K`U 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`%0KH- M  0K  0S 0!0 0 0 H  00 ҩ000S0  00  00  00  0  Ǣ 00 0 000S00 0  00 00  00 00  00 00  00 0  㙢 00 0 000S00  000  000  000  00  p000S0 0  0 00  0 00  0 00  0 00 G 00 0 00 (000S00  000  000  000  00   00 0 0  00 0 0 0,0 000S000  0000  0000  0000  000  00 0 0 , 000 0 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0Bd0S0=00 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d 咦 0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 00  0S 000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` 7 0S 040 L0K` * 0S 0L0080 0S 8 400c0 80 0 `000ST0K0 0 00T K 00T K 00T K T0K  00 0 `000SX0K0 0 00X K 00X K 00X K X0K  ̠ 00 0 `000S<00 0 00<  00<  00<  <0  㨠`000S 00<   00<   00<   00<   0 <00  00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  V 00 0 5`000S000 0 00   00   00  00  , 00 0 0 00  !00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S000 0 00   00   00  00  ̟ 00 0 0 00  00 0 0 0Sd0SHl008 K`彧 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`፧0KH-M@@  00 0  0S 0'00 0 0S 0t00 0 0S 0 D00 0 0S 00K0n (`H-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0ᝥ 0S N7?OR0 0 $0$00 00 , K  0) 0S" $02;S 00 , K  0 0S,0 ,0   80 0 0 ,0 040R ,0 040R*00,0 080R ,0 080R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 0400 t0SC<0S <0S=$0 ,0K    0㥣 0S $ ,00 ) S, 0 00 C,08 $02;S: 00S3$0$$00 ,0峦 0S& -<0S <0S $0 ,0K    0a 0S $ ,00  ,0 4  80 0 0 ,0S , $00奨 0S 0S0 0 0S 00(0S (0] 0S 0S0 0 0KH-0M $ ( ,0 00 00 00 00 $0 0K  ᠞ 0S 000s ,0S ,0S0 0 0 0 000 K  ,0S ,0Sx 0S% 0K  7 0S 026;208 000 v00 000  ᝣ 0Sz00 0800 040 ]0$ 080ὥ 0Se0 "0 "+"0$0 < 00 0SJ 00  0S0 L  00 0S 2 0S.,0S ,0S 0S 000 00  Y 0S N7?OR0 0  (0 0S 00 0S 0S 0 t 0S 0S0 0 0S 0  0KH-(M  $0 00 00 0 0K  0S 070H00 $0S $0S 0,0 00,$0S $0S 00 0,0ڛ  0 0 0 0S 0ᐤ 0KH-(M  $0 00 00 0 0K Ṟ 0S 0!$0S $0S 0,0 00 㝛  0 0 0 0S 0S 0KH-0M   0 0 00 K ѡ 0S 0K 0  0 "#"  002 8@0020;0090 0        0j 0S 020s0S 02 0" 0 0  0 02@0S 0 n0KH-MI@  0 000 0$0 $0 0 0|0 0S00s0S 000 000s0S 0S 00 K0  0ዚ 0S 02@0K {0@0 妝0<0 \0K pD00D0  081 0S 0000S  000S 0S 80@K\ K# 0S S:S 0S 0 0S0T \0 N000S3 0K T 0K0 T  0K0 T  0K0 T  0T0 K 0T00 K 0T00 K 0T00 K 0$0T 00|K F 0SP|00 S!|0X0S 0$|0X 00K , 0S8 0᚜ 0S 00 ? |0᎜ 0S 0|0 30|0 00S000s0S 00$K0  0᪙ 0S 0@0 ̜0<0 x0K 㖡`0>`0 $@ Kx0K 0[ 0S00 40 3 6?OR$@ K\0K 0ߢ 0S 09 0S $01 6?ORN R00s0S 0;S 00 0T \0 \000S 0K T 0K0 T  0K0 T  0K0 T  0T0 K 0T00 K 0T00 K 0T00 K 00s0S 0S 00 w0 0| K 0Si|0 0T |000 000S+ 0K K 0K0 K 0K0 K 0K0 K 0K K 0K0 K 0K0 K 0K0 K x0K 㷠0Kx0 0t0 @ Kx0K 0 0S02 0" |0S 0$ 0 |  00H 0S 0S00 \0S \0 0S 0 0S 0S00 $0S $0 0S 0S00 0K_ H-(M $ ( ,0 000 000 00 0S'00S0 002R * 002 0 0S 0*00<0 0Y 0S 0 02;S ,0S  (  0S 0 00S 0(0 㸠 0S 000SW 0P0SS$0S 026SK 027SF 02;S , (  02;S,00  0y 0S 000S' 00S 00H0S 00H0 20S00S 00L0@0S  026S $吙 0S 00H0S 0H0ᤠ0S 7?O0 0 0P00 5 02;S08 080 I0S0T 0T0R#,0S 02;S 000S 000,凡0S 0L 0R0L0 0 000 0S0S 0 0L 0P 0 00S 0P0   0 0T 0 P 0P 0 0L 0L 0 0 00S 00   0 0T 0  0 0 0H0S 0H0ᩗ0S 7?O0KH-pM40` d h `   ` ")R ` ")R 0 `   BR\-A`0"28@0S 000 00S `00S `000 00 E00 00S `00S `000 00 3`0"28@0S 000 `00S `0000 ` ""R 00 00 ` "+R 00 00 0 0 `  0 0`0$00 \0K ``080\ K 4 0S `080͟ey X`00H0 `0"28@0D0 `0 0@0 H0K<0 080 <0Kە0010S `022S `0 0S `0 0S h00h0 h 00  ! R   `029S <00`   d R 0S `0$0ݝ`0$0ᛞ`02;S `02+`0"`0$0 0`02)`0"0S d0S `0$ `080ᮚ`0 "0KP H-0M $ ( 00 0 00 00 $0S $ 0t0K $( ם 0S 0C 0H0S 0H0 ᵞ0S 7?O4 0L0 C 0L 0L00 0H0S 0H0 10S 7?O 000S 0S  00! 0S 0S00 ).a  吞0KH-hMX \ ` d0 00 X000 00 0 0S 000 00 X0$0S`00`0 X029S X000 01S 01 !!01 !  0S 0S00 010 0SX01 0  0 0$0 0 0S 0 0   00  00 ! )$0 0 0SX01S X 0S 0S00 `00SX0"@0 0@0S X 0S 0S00 X00S00(0 ,^ 0S 0S00 X00,0 ,0S ,# 0S 0S00 X00,0 ,0S ,僠 0S 0S 00 X00,0 ,0S(0S `00SX0"@0 0@0SX0$0ǘ 0S 0S00 0S^X000SY X0P0SU X026S00S 00H0S 00H0 20s0SX0| 0H0R X t 0S0S00 X] 0S& 0S"00 X\  0S \0S \X 嗔 0S 嶛0d0S d0 0X00S X00| 0S 0S00 0H0S 0H0 0S 7?O0S X00SX00S X00S X00X  X0 0T X00X  X0 X0 X0$0S' X0$ X02@0S00៛ 0S 0S00 X0 $ 0S X0$0N 0S 0S00 0H0S 0H0A0S 7?OYXV 0S 0S00 X 0S 0S00 X02X- 0S 0S00 0SDX0X0S@ \0SX0`0\0 \0S \000SX0h X0X0\<0T0 0H0 X0X T0K 1 0S 0S00 X0X0ẖ 0S 0S00 X0 X X0 h 00S% X02;S X02SX0800S 0X080 40K 8 0S40ᇖ 0S00 0S: X0";0A000 X嵙 0S 0X 0S 0X\ 0S 0X0"00 X0"00;S X080 ĚX02+X0"X0$0 ǒ0X0 X0(0y 0S 0S00 X0,0S X0 X0,0͛X0 , X000S X0 X000ΊX0 0 X00S X0 X00ᱛX00S X0 X00ᦛX00S X0 X00ᛛX00 cX00 ]X00 WX080 QX0 L X0 T X0 \ X0 ` X0 d X0 x X0 4 \0S X0 h X0"X0"0KH-M10      x \ | < !R  R  R    0ṝ00 0 ! p 0S 0S00 00 0 0S02$0"0K= H-M 01S060 0K 0S 0)010 0 0 010 0 00 0 0R0 0S 0 0   00  00ښ00 0S 0KH-HM0 4 8 <0 0000S 40S0$0K ㉙000 0 0$0 ,0K<  $ K 8  04 0? 0S0, K0KH-00 L0>L0 ,,081 0S ,0000S,000S 80HKd K\  6?OR00 00 ,0$ $0S 0S$00 0,0 0Sl0 !0 !0\!0x"0& \!040 $01SF $00 0 $01 0(K % 0S(081 0S 0000S000S 80KL K{ 0S  6?OR  6?OR6?O0 (00 0S$0 0 $0 0,K  0S 00s0S 0000 000s0S ,0, 8!*8!$020SGh0K [P00P0 ,081 0S 0000S000S 80Kh K 0S$ h0K P h0ϓ0S 1010 10ٔ00  6?OR  6?OR, 0K 0 00s0S 0ᢓ000 ,0ᙍ 0S 0S 00 0S00$ Kណ $0S 0S 00S 00j 0S 0S 00 $0S $ 00U 0S 0S 00 0K H- M  $0 000 0 0 0K ᴐ 0S 0K0 㑐0  0  0 $   0(0S 0(0ᙑ0S 7?O+0 ! 0S 01    0!0 F/ 0(0S 0(0 0S 7?O 01S 00 ! 0K- M  0  0Ћ/- M  0 0 0Ћ/H-(M  $0 0K 8 0S 0Q$0 0 0 d  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  ш 00 0 000S00  000  000  000  00  㨈000S0 0  0 00  0 00  0 00  0 00  00 0 000S00  000  000  000  00  V 00 0 000S0K  0K0  0K0  0K0  0K  20  00 0 0S 0 0 00 垊 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  · 00 0 000S0 0  0 00  0 00  0 00  0 0  㥇 00 0 0$0 ㆎ000S0(0  0(00  0(00  0(00  0(0  v 00 0 0 $ 0(0 0 0 0@0 O000S0D0  0D00  0D00  0D00  0D0  ? 00 0 0 @ 0D0 0 0 000S0\0  0\00  0\00  0\00  0\0  000S0`0  0`00  0`00  0`00  0` 00 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 )0`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l 囋 0S 0pl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0shw 0S 060S 00, , 0S 00000<0 00S 000< 3/ < 00<0 0Sl0S < @0K 2 0S 0<0 T0K % 0S 0T00@0 0S @ <00c0 @0 0 000S`0K0 0 00` K 00` K 00` K `0K  00 0 000Sd0K0 0 00d K 00d K 00d K d0K  Dž 00 0 000SD00 0 00D  00D  00D  D0  㣅000S 00D   00D   00D   00D   0 D00 z 00 0 000S00 0 00  00  00  0 V 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  . 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 000S 00 0 00  00  00  0  00 0 000S00 0 00  00  00 0  00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  㗄 00 0 5000S000 0 00   00   00  00  m 00 0 0 00  b00 0 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  7 00 0 5000S000 0 00   00   00  00  00 0 0 00  00 0 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h `0S000 0S 0000S00 0 00  00  00 0  㣃000S 00   00   00   00  0 00 z  _ 00 0 0Sl0SPt00@ Ks 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0C0KH-(M  $0 0K  0S 0$0 0 0 X  00 00  000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  㲂 00 0 000S00  000  000  000  00  ㉂000S0 0  0 00  0 00  0 00  0 00 ` 00 0 000S00  000  000  000  00  7 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 0S 0 0 00  000S0K  0K0  0K0  0K0  0K  ہ0  00 0 000S0K  0K0  0K0  0K0  0K  㴁0  00 0 000S0K  0K0  0K0  0K0  0K  ㍁0  00 0 0$0 k000S0(0  0(00  0(00  0(00  0(0  [ 00 0 0 $ 0(0 0 0 000S0@0  0@00  0@00  0@00  0@0  *000S0D0  0D00  0D00  0D00  0D 00  00 0 000S0H0  0H00  0H00  0H00  0H0  ؀000S0L0  0L00  0L00  0L00  0L 00 㯀 00 0 000S0P0  0P00  0P00  0P00  0P0  ㆀ000S0T0  0T00  0T00  0T00  0T 00 ] 00 0  0 0KH-xMp t x |0 0\0 \0\0 p000 x0X0 +0h0 00 00 |00Sp029S t0S0A00 00 t0S0l0 T0KL0 0P0 P0T0 ;t0@0S h0t  0S 0!t0 00 00L0 t0000@0S 0 0t00,0 0 000 0 0S00 0 00S 00S 0X0 t0 0l0 p0P0 0sp 0S 00S 00@0@0D0 00S 000D 3/ D 00D0 0St0S D H0K ᳆ 0S 0D0 \0K ᦆ 0S 0\00H0 0S H D00c0 yH0 0 000Sh0K0 0 00h K 00h K 00h K h0K  l 00 0 000Sl0K0 0 00l K 00l K 00l K l0K  H 00 0 000SL00 0 00L  00L  00L  L0  $000S 00L   00L   00L   00L   0 L00 ~ 00 0 000S00 0 00  00  00  0 ~ 00 0 p0P0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  ~ 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  ~ 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  c~ 00 0 0d0 000Sd0K0 0 00d K 00d K 00d K d0K  =~ 00 0 0S&0`0 000S`0K0 0 00` K 00` K 00` K `0K  ~ 00 0 5000S000 0 00   00   00  00  } 00 0 0 00  }00 0 0 0S t0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S p =0S000 0S 0000S00 0 00  00  00 0  }000S 00   00   00   00  0 00 W}  < 00 0 0S t0S2 00<0(0 0 (000R 0 (000R030#s00 (040R 0 (040R:00s0S p 岁0S000 0S 0(000S00 0 00  00  00 0  |000S 00   00   00   00  0 00 |  㱃 00 0 0S t0S2 00<0,0 0 ,000R 0 ,000R030#s0 0 ,040R 0 ,040R:00s0S p '0S000 0S 0000S 00 0 00  00  00  0  j|000S 00   00   00   00  0 00 A|  & 00 0 0St0SX|00H K: 0S0t0S* L0X X x0R$ X x0 00 \0t P 0S\0 t0T \ t0P t0 0t  `  ` x0 x0  0St0SH0 0KH-(M  $0 0K  0S 0$0 0 0 $  00 㶂00  000S0  00  00  00  0  { 00 0 000S00 0  00 00  00 00  00 00  00 0  y{ 00 0 000S00  000  000  000  00  P{000S0 0  0 00  0 00  0 00  0 00 '{ 00 0 000S0K  0K0  0K0  0K0  0K  {0  00 0 0S 0 0 00 o} 000S0K  0K0  0K0  0K0  0K  z0  00 0 000S0K  0K0  0K0  0K0  0K  z0  00 0 000S00  000  000  000  00  xz000S0 0  0 00  0 00  0 00  0 00 Oz 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 ,0\0 00 00 t00Sh029S l0S0z0 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l  0S 0Zl0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0sh 0S 0 $0<0 00S 000< 3/ < 00<0 0Sl0S < @0K ᬀ 0S 0<0 T0K ៀ 0S 0T00@0 0S @ <00c0 r@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  ey 00 0 000S`0K0 0 00` K 00` K 00` K `0K  Ay 00 0 000SD00 0 00D  00D  00D  D0  y000S 00D   00D   00D   00D   0 D00 x 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  x 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  x 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  x 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s0 0 $040R 0 $040R:00s0S h |0S000 0S 0000S 00 0 00  00  00  0  #x000S 00   00   00   00  0 00 w  ~ 00 0 0Sl0SPt00@ K 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@00KH-(M  $0 0K ~ 0S 0$0 0 0 <  00 o~00  000S0  00  00  00  0  `w 00 0 000S00 0  00 00  00 00  00 00  00 0  2w 00 0 000S00  000  000  000  00  w000S0 0  0 00  0 00  0 00  0 00 v 00 0 000S00  000  000  000  00  v 00 0 000S0K  0K0  0K0  0K0  0K  v0  00 0 0S 0 0 00 x 000S0K  0K0  0K0  0K0  0K  [v0  00 0 000S00  000  000  000  00  /v000S0 0  0 00  0 00  0 00  0 00 v 00 0 000S0K  0K0  0K0  0K0  0K  u0 $ 00 0 000S0(0  0(00  0(00  0(00  0(0  u000S0,0  0,00  0,00  0,00  0, 00 u 00 0 000S0K  0K0  0K0  0K0  0K  iu0 0 00 0 000S040  0400  0400  0400  040  =u000S080  0800  0800  0800  08 00 u 00 0  0 0KH- M  0KA | 0S 00 0 0 l  00 {000S0  00  00  00  0  t 00 0 000S00 0  00 00  00 00  00 00  00 0  t 00 0 000S00  000  000  000  00  ut000S0 0  0 00  0 00  0 00  0 00 Lt 00 0 00 -{000S00  000  000  000  00  t 00 0 0  00 0 0 000S0K  0K0  0K0  0K0  0K  s0 , 00 0 000 z000S040  0400  0400  0400  040  s 00 0 0 0 040 0 0 0L0 z000S0P0  0P00  0P00  0P00  0P0  s 00 0 0 L 0P0 0 0 000S0h0  0h00  0h00  0h00  0h0  Ws 00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 /0X0 00 00 l00S d0S0d0S000 00 d0S0\0 D0K<0 0@0 @0D0 ,d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0\0 0S 00  0S 000 0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` y 0S 0h40 L0K` y 0S 0[L0080 0S 8 400c0 y80 0 `000SX0K0 0 00X K 00X K 00X K X0K  tr 00 0 `000S\0K0 0 00\ K 00\ K 00\ K \0K  Pr 00 0 `000S<00 0 00<  00<  00<  <0  ,r`000S 00<   00<   00<   00<   0 <00 r 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  q 00 0 5`000S000 0 00   00   00  00  q 00 0 0 00  q00 0 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K  }q 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  Tq 00 0 5`000S 000 0 00   00   00   00  *q 00 0 0 00  q 00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  p 00 0 5`000S000 0 00   00   00  00  p 00 0 0 00  p00 0 0 `000S00 0 00  00  00 0  p 00 0 0Sd0SHl008 K`x 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`gx0KH-(M  $0 0K =w 0S 0h$0 0 0   00 w00  000S0  00  00  00  0  p 00 0 000S00 0  00 00  00 00  00 00  00 0  o 00 0 000S00  000  000  000  00  o000S0 0  0 00  0 00  0 00  0 00 o 00 0 000S0K  0K0  0K0  0K0  0K  `o0  00 0 0S 0 0 00 q 000S0K  0K0  0K0  0K0  0K  (o0  00 0 000S00  000  000  000  00  n000S00  000  000  000  0 00 n 00 0  0 0KH-pMh l p t0 0T0 T0T0 h000 p0P0 00\0 00 00 t00Sh029S l0S0T0 0 0 0 l0S0`0 L0KD0 0H0 H0L0 ;l0@0S \0l s 0S 04l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0P0 l0 0`0 h0P0 0shex 0S 0 0<0 00S 000< 3/ < 00<0 0Sl0S < @0K 0u 0S 0<0 T0K #u 0S 0T00@0 0S @ <00c0 t@0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  m 00 0 000S`0K0 0 00` K 00` K 00` K `0K  m 00 0 000SD00 0 00D  00D  00D  D0  m000S 00D   00D   00D   00D   0 D00 xm 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  Pm 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  *m 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h q0S000 0S 0000S00 0 00  00  00 0  l000S 00   00   00   00  0 00 l  s 00 0 0Sl0SPt00@ Kt 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0   0Sl0S@0mt0KH-(M  $0 0K Cs 0S 01$0 0 0 4  00 s00  000S0  00  00  00  0  l 00 0 000S00 0  00 00  00 00  00 00  00 0  k 00 0 000S00  000  000  000  00  k000S0 0  0 00  0 00  0 00  0 00 k 00 0 000S0K  0K0  0K0  0K0  0K  fk0  00 0 0S 0 0 00 m 000S00  000  000  000  00  )k000S00  000  000  000  0 00 k 00 0 000S0K  0K0  0K0  0K0  0K  j0  00 0 000S0 0  0 00  0 00  0 00  0 0  j000S0$0  0$00  0$00  0$00  0$ 00 j 00 0 000S0K  0K0  0K0  0K0  0K  cj0 ( 00 0 000S0,0  0,00  0,00  0,00  0,0  7j 00 0 000S0K  0K0  0K0  0K0  0K  j0 0 00 0  0 0KH-(M  $0 0K p 0S 0X$0 0 0 8  00 p00  000S0  00  00  00  0  i 00 0 000S00 0  00 00  00 00  00 00  00 0  i 00 0 000S00  000  000  000  00  li000S0 0  0 00  0 00  0 00  0 00 Ci 00 0 000S0K  0K0  0K0  0K0  0K  i0  00 0 0S 0 0 00 k 000S00  000  000  000  00  h000S00  000  000  000  0 00 h 00 0 000S0K  0K0  0K0  0K0  0K  h0  00 0 000S0 0  0 00  0 00  0 00  0 0  ih000S0$0  0$00  0$00  0$00  0$ 00 @h 00 0 000S0K  0K0  0K0  0K0  0K  h0 ( 00 0 000S0,0  0,00  0,00  0,00  0,0  g 00 0 000S0K  0K0  0K0  0K0  0K  g0 0 00 0 000S0K  0K0  0K0  0K0  0K  g0 4 00 0  0 0KH-pMh l p t0 0X0 X0X0 h000 p0T0 10`0 00 00 t00Sh029S l0S0u0 0 0 0 l0S0d0 P0KH0 0L0 L0P0 ;l0@0S `0l Xl 0S 0Ul0 00 00H0 l0000@0S 0 0l00,0 0 000 0 0S000 00S00S0T0 l0 0d0 h0P0 0sh4q 0S 080@0 00S 000@ 3/ @ 00@0 0Sl0S @ D0K m 0S 0@0 X0K m 0S 0X00D0 0S D @00c0 mD0 0 000S`0K0 0 00` K 00` K 00` K `0K  f 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  f 00 0 000SH00 0 00H  00H  00H  H0  pf000S 00H   00H   00H   00H   0 H00 Gf 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  f 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h j0S000 0S 0000S00 0 00  00  00 0  e000S 00   00   00   00  0 00 e  ~l 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  ne 00 0 0S l0S2 00<0(0 0 (000R 0 (000R030#s0 0 (040R 0 (040R:00s0S h i0S000 0S 03000S 00 0 00  00  00  0  e000S 00   00   00   00  0 00 d  k 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  d 00 0 000S00 0 00  00  00 0  d 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  sd 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  Md 00 0 0Sl0STt00D KKl 0S0l0S* H0T T p0R$ T p0 00 X0l P 0SX0 l0T X l0P l0 0l  `  ` p0 p0   0Sl0SD0l0KH-(M  $0 0K j 0S 0$0 0 0 D  00 j00  000S0  00  00  00  0  c 00 0 000S00 0  00 00  00 00  00 00  00 0  c 00 0 000S00  000  000  000  00  ac000S0 0  0 00  0 00  0 00  0 00 8c 00 0 000S0K  0K0  0K0  0K0  0K  c0  00 0 0S 0 0 00 e 000S0K  0K0  0K0  0K0  0K  b0  00 0 000S00  000  000  000  00  b000S00  000  000  000  0 00 b 00 0 000S0K  0K0  0K0  0K0  0K  cb0  00 0 0$0 Ai000S0(0  0(00  0(00  0(00  0(0  1b 00 0 0 $ 0(0 0 0 000S0K  0K0  0K0  0K0  0K  b0 @ 00 0  0 0KH-0M $ ( ,0 0K  h 0S 03,0 0 0 H  00 h00(  000S0  00  00  00  0  a 00 0 000S00 0  00 00  00 00  00 00  00 0  a 00 0 000S00  000  000  000  00  ^a 000S0 0  0 00  0 00  0 00  0 00 5a 00 0 000S0K  0K0  0K0  0K0  0K  a0  00 0 $0S $0 0 00 $ }c 000S0K  0K0  0K0  0K0  0K  `0  00 0 000S00  000  000  000  00  ` 000S00  000  000  000  0 00 ` 00 0 000S0K  0K0  0K0  0K0  0K  ``0  00 0 0$0 >g 000S0(0  0(00  0(00  0(00  0(0  .` 00 0 0 $ 0(0 0 0 000S$0S $00S $00$ 0(0 0f 0S 0Q 000S0K  0K0  0K0  0K0  0K  _0 @ 00 0 000S0K  0K0  0K0  0K0  0K  _0 D 00 0  0 0KH-xMh l p t0 0T0 T0T0 h000 p0P0 20`0 00 00 t00Sh029S l0S0A00 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l od 0S 0!l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0shKi 0S 00S 000000<0 00S 000< 3/ < 00<0 0Sl0S < @0K f 0S 0<0 T0K f 0S 0T00@0 0S @ <00c0 e@0 0 000S`0K0 0 00` K 00` K 00` K `0K  ^ 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  ^ 00 0 000SD00 0 00D  00D  00D  D0  ^000S 00D   00D   00D   00D   0 D00 W^ 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  /^ 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  ^ 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h ib0S000 0S 0000S00 0 00  00  00 0  ]000S 00   00   00   00  0 00 ]  hd 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  X] 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  /] 00 0 I000S000 0 00   00   00  00  ] 00 0 0 00  \000S00 h  0c 0S 000 0 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  \ 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  \ 00 0 0Sl0SPt00@ Kd 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0fd0KH- M  0K =c 0S 00 0 0   00 c000S0  00  00  00  0  \ 00 0 000S00 0  00 00  00 00  00 00  00 0  [ 00 0 000S00  000  000  000  00  [000S0 0  0 00  0 00  0 00  0 00 [ 00 0   0 0KH-`MX \ ` d0 0L0 L0L0 `0H0 30P0 00 00 d00S \0S0s\0S0n0 0 0 0 \0S0T0 D0K<0 0@0 @0D0 ;\0@0S P0X\ A` 0S 0N\0 00 00<0 \0000@0S 0 0\00,0 0 000 0 0S000 00S00S0H0 \0 0T0 040 X00S X0004 3/ 4 0040 0S\0S 4 80KX a 0S 040 L0KX a 0S 0L0080 0S 8 400c0 a800 X000SP0K0 0 00P K 00P K 00P K P0K Z000 X000ST0K0 0 00T K 00T K 00T K T0K Z000 X000S<00 0 00<  00<  00<  <0 fZX000S00<   00<   00<   00<  0 <00 =Z000 0S\0SHd008 KX;b 0S0\0S* <0H H `0R$ H `0 00 L0\ P 0SL0 \0T L \0P \0 0\  `  ` `0 `0   0S\0S80X b0KH-(M  $0 0K ` 0S 0$$0 0 0 `  00 `00  000S0  00  00  00  0  Y 00 0 000S00 0  00 00  00 00  00 00  00 0  zY 00 0 000S00  000  000  000  00  QY000S0 0  0 00  0 00  0 00  0 00 (Y 00 0 000S0K  0K0  0K0  0K0  0K  Y0  00 0 0S 0 0 00 p[ 000S0K  0K0  0K0  0K0  0K  X0  00 0 000S00  000  000  000  00  X000S00  000  000  000  0 00 wX 00 0 000S0K  0K0  0K0  0K0  0K  SX0  00 0 0$0 1_000S0(0  0(00  0(00  0(00  0(0  !X 00 0 0 $ 0(0 0 0 000S0K  0K0  0K0  0K0  0K  W0 @ 00 0 0D0 ^000S0H0  0H00  0H00  0H00  0H0  W 00 0 0 D 0H0 0 0  0 0KH-0M $ ( ,0 0K  ^ 0S 0h,0 0 0 d  00 }^00(  000S0  00  00  00  0  nW 00 0 000S00 0  00 00  00 00  00 00  00 0  @W 00 0 000S00  000  000  000  00  W 000S0 0  0 00  0 00  0 00  0 00 V 00 0 000S0K  0K0  0K0  0K0  0K  V0  00 0 $0S $0 0 00 $ 6Y 000S0K  0K0  0K0  0K0  0K  V0  00 0 000S00  000  000  000  00  fV 000S00  000  000  000  0 00 =V 00 0 000S0K  0K0  0K0  0K0  0K  V0  00 0 0$0 \ 000S0(0  0(00  0(00  0(00  0(0  U 00 0 0 $ 0(0 0 0 000S0K  0K0  0K0  0K0  0K  U0 @ 00 0 000S0K  0K0  0K0  0K0  0K  U0 D 00 0 0H0 r\ 000S0L0  0L00  0L00  0L00  0L0  bU 00 0 0 H 0L0 0 0 000S$0S $00S $00$0( 0H0[ 0S 0 0 0KH-xMh l p t0 0T0 T0T0 h000 p0P0 40`0 00 00 t00Sh029S l0S000 00 l0S0d0 L0KD0 0H0 H0L0 ;l0@0S `0l Y 0S 0l0 00 00D0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0P0 l0 0d0 h0P0 0sh^ 0S 0_0S 004 4 0S 0000<0 00S 000< 3/ < 00<0 0Sl0S < @0K [ 0S 0-<0 T0K ~[ 0S 0 T00@0 0S @ <00c0 Q[@0 0 000S`0K0 0 00` K 00` K 00` K `0K  DT 00 0 000Sd0K0 0 00d K 00d K 00d K d0K  T 00 0 000SD00 0 00D  00D  00D  D0  S000S 00D   00D   00D   00D   0 D00 S 00 0 h0P0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  S 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  S 00 0 0S l0S2 00<0$0 0 $000R 0 $000R030#s00 $040R 0 $040R:00s0S h W0S000 0S 0000S00 0 00  00  00 0  (S000S 00   00   00   00  0 00 R  Y 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  R 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  R 00 0 I000S000 0 00   00   00  00  R 00 0 0 00  vR000S00 h  0Y 0S 0 00 0 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  :R 00 0 0\0 000S\0K0 0 00\ K 00\ K 00\ K \0K  R 00 0 0S&0X0 000SX0K0 0 00X K 00X K 00X K X0K  Q 00 0 E000S000 0 00   00   00  00  Q 00 0 0 00  Q000S 000s0S 00Y00 0 0 0Sl0SPt00@ KY 0S0l0S* D0P P p0R$ P p0 00 T0l P 0ST0 l0T T l0P l0 0l  `  ` p0 p0  0Sl0S@0rY0KH-0M $ ( ,0 0K  HX 0S 0,0 0 0 P  00 X00(  000S0  00  00  00  0  Q 00 0 000S00 0  00 00  00 00  00 00  00 0  P 00 0 000S00  000  000  000  00  P 000S0 0  0 00  0 00  0 00  0 00 P 00 0 000S0K  0K0  0K0  0K0  0K  kP0  00 0 $0S $0 0 00 $ R 000S0K  0K0  0K0  0K0  0K  3P0  00 0 00 W 000S00  000  000  000  00  P 00 0 0  00 0 0 040 V 000S080  0800  0800  0800  080  O 00 0 0 4 080 0 0 000S$0S $00S $000 040YV 0S 0 0 0KH-xMh l p t0 0P0 P0P0 h000 p0L0 <0\0 00 00 t00Sh029S l0S000 00 l0S0`0 H0K@0 0D0 D0H0 ;l0@0S \0l  0S 0l0 00 00@0 l0000@0S 0 0l00,0 0 000 0 0S00 0 00S 00S 0L0 l0 0`0 h0P0 0sh7Y 0S 0b0S 00 0S 000080 00S 0008 3/ 8 0080 0Sl0S 8 <0K U 0S 0080 P0K U 0S 0#P00<0 0S < 800c0 U<0 0 000S\0K0 0 00\ K 00\ K 00\ K \0K  N 00 0 000S`0K0 0 00` K 00` K 00` K `0K  N 00 0 000S@00 0 00@  00@  00@  @0  dN000S 00@   00@   00@   00@   0 @00 ;N 00 0 h0P0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  N 00 0 0X0 000SX0K0 0 00X K 00X K 00X K X0K  M 00 0 0S&0T0 000ST0K0 0 00T K 00T K 00T K T0K  M 00 0 I000S000 0 00   00   00  00  M 00 0 0 00  M000S00 h  02T 0S 000 0 0 0S&0T0 000ST0K0 0 00T K 00T K 00T K T0K  PM 00 0 E000S 000 0 00   00   00   00  &M 00 0 0 00  M000S  000s0S 00'U 00 0 0 0Sl0SLt00< KU 0S0l0S* @0L L p0R$ L p0 00 P0l P 0SP0 l0T P l0P l0 0l  `  ` p0 p0  0Sl0S<0T0KH-(M  $0 0K S 0S 0?$0 0 0 L  00 S00  000S0  00  00  00  0  tL 00 0 000S00 0  00 00  00 00  00 00  00 0  FL 00 0 000S00  000  000  000  00  L000S0 0  0 00  0 00  0 00  0 00 K 00 0 000S0K  0K0  0K0  0K0  0K  K0  00 0 0S 0 0 00 E0,0 ,0(0 0K 5E000 T1S0T1 <000s0S H181:S< 0H181:S H1 H10H< x?( (0S (0800S 0K D8, , p0K< A( (0S0 0 00 H181 0S H1000SH100S ;0@0 T1S@00K KH>( ( 6?OR6?O(0 (0S00 L100 L100 P10 0S> 0S. 0S+l0KH >( (0Sl@00K Kp>( ( 6?OR ( 6?OR0 0 0(0 l0(AD D0S D0(0 (0S00 K0K8P![( (0S00 00 80 0S802;S80 0SK80 0S80,1 000 80,10$0 80$1000 80$10$0 0S 0P10H0 H 00R<H0 >( H 00R *0K<0 F( (0Sl0S P10H ?= H0 0H00c$ D000 00 X0K8xC( p00 %0S 0SX010s0S X0 X0S 0KP1 K 0t0 `@00 K|=( ( 6?OR ( 6?OR6?O(0 00 0 400C40 000 40S000 0040 (`0S 0K Ct0>t0 `@00 KF=( ( 6?OR ( 6?OR6?O(0 00 0 00 040 `0S `0?D D0S (0SD0(0 0`0 (0S0S X 0KKH ( ( 6?OR? (0Sx40S; XH1 H1 X0 0HhK D( (0Sb<000s0S h0h 8!*8!X01 0S X01 0SX023S O?K  O?K0  O?K0  O?K0  0O/K 00O/K 00O/K 00O/K 000Sw X020S80K B000 h@00 K<( (0SX K0K AL 0<LEL0S <4040 40VF0(0 ( 6?OR/ ( 6?OR* HX02<S$M?K B0041 0001 F?K B01 01 h@00MKF/KF<( ( 6?OR ( 6?ORh 0K 0C( ( 6?OR0(0 400C40 000 40S (0Su X01 0S X01 0S0X023S+ =K  =K0  =K0  =K0  0-K 00-K 00-K 00-K h0>D D0S (0SD0(0 (0SG00 0 H10X K?( 000 X0S (0S (0S+0Sll0KH I;( (0S!L100 L100 l@00K K;( ( 6?OR ( 6?OR0 0 0(0 l0T>D D0S (0SD0(0 (0S 0S<X0K8A( p00 "X010s0SX 0KKH t( (0S ( 6?ORH10X K5?( 000 X0S (0S (0SD pxH100S< T1S T1S T1S3H10S H100000s0S 6?O(0 H141H3/( (0S\0KH C( (0S\000d0 d00d0 LP!T1  6?OR$J: 01 0S 01 0S8023S3 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 000s0S 00($0 0\0 026Sc X0K ;@00@0 00<KX K`4 0S 0`0 `0 0 0` K G< 0S 0` , 0` H $ 0` d ( 00XK< K4 0S  0 0< Kh 4 X0Z= 0S 0Q7 0S 0S00 0S 0/`0$0`0$0 \0K h 0t7 0S 0 026S <0K`d l0Z40`0(0`0(0 \0K d 0S70KH-M(00  0>0K謾 H-pM` `001 0 000 `081 0S `0000S`000S ;00 80K A:T0K <: 0> 0 8 KT0K` 04 0S 0`001 0S `001 0S1`0023S+ X0KT  X0K0T  X0K0T  X0K0T  T0X K T00X K T00X K T00X K `0 `0 0 0`K <; 0S 0/000s0S 0 8!*8!00TK8 K3 0S09  6?OR 5 0K6 0S 0S00 0KH-M 000 000 081 0S 0000S000S ;00 `0K 9D0K |9` KD0K 0E3 0S 0X|0K j9$0K8 "$0 $`KD K|0K+ "2* *0 0S 0 +0KH-0M $ ( 000 00 0 0 $02<SO $02<S $020s0S 00@00 (00S S0CS(0w? 0 <0 (00S (00S(00S00 $02<S (0000 0 $000 0S 00( (00a  0[000 ",R  " r R  @ [  0bs00C1K 02<S 020s0S 00@0[00000 0 1[ 0 0 V0S P0K  P0K0  P0K0 0 00P K 20K  $ 00 0 20K  $R0K  R0K0  R0K0 0 00R K 00 0 3[ 0 0 T0K  T0K0  T0K0 0 00T K 00 0  0R: 02<S 020s0S 00@0[00000 0 X0K  X0K0  X0K0  X0K0  X0K0 0 00X K 00X K 00X K 00 0 02<S 020s0S 00@0[00000 0 \0K  \0K0  \0K0  \0K0  \0K0 0 00\ K 00\ K 00\ K 00 0 `0K  `0K0  `0K0  `0K0  `0K0 0 00` K 00` K 00` K 00 0 #00[00K01 [R:0S00K"b0K [  b0K0 [    0[00b K  0[000b K 0[00K01 [R:00K]0S d0K [  d0K0 [    0[00d K  0[000d K 00S`0[S]0S 0[0 0 0[0C000RMf0K [  f0K0 [    0[00f K  0[000f K 0[0 0 0[0C000R h0K [  h0K0 [    0[00h K  0[000h K 02<S 020s0S 00@0[0000$0 $ 0R*$000S SSj0K$  j0K0$  $0j K $00j K o$0(0 p0K(  p0K0(   p0K0(   p0K0(   (00p K (000p K (000p K (000p K t0K(  t0K0(   t0K0(   t0K0(   (00t K (000t K (000t K (000t K "00S#v0K [  v0K0 [    0[00v K  0[000v K 0[00K01 [R:B00K^0S x0K [  x0K0 [    0[00x K  0[000x K 02<S 020s0S 00@0[0000,0 , 0R*z0K,  z0K0,  ,0z K ,00z K 0K,  0K0,   0K0,   0K0,   ,00 K ,000 K ,000 K ,000 K 0K,  0K0,   0K0,   0K0,   ,00 K ,000 K ,000 K ,000 K ,000St SmSk,0 0(0 0K(  0K0(   0K0(   0K0(   (00 K (000 K (000 K (000 K 0K(  0K0(   0K0(   0K0(   (00 K (000 K (000 K (000 K  !090S!0K [  0K0 [    0[00 K  0[000 K 0[00K01 [R:00K0S 0K [  0K0 [    0[00 K  0[000 K 02<S 020s0S 00@0[000000 0 0R*0K0  0K00  0K00  0K00  00 K 000 K 000 K 000 K 0K0  0K00   0K00   0K00   000 K 0000 K 0000 K 0000 K 0S!0K [  0K0 [    0[00 K  0[000 K 0[00K01 [R2:  040S+0K  0K0  0K0  0K0  0 K 00 K 00 K 00 K 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 0K  0K0   0K0   0K0   0 0 K 0 00 K 0 00 K 0 00 K 0K  0K0   0K0   0K0   00 K 000 K 000 K 000 K 0K  0K0   00 K 000 K 0K  0K0   00 K 000 K 0KH-0M $ ( ,0 00 0 $00 S $0 00 $(0$0 M 00,0 0S& 0K$   0K0$   0K0$   0K0$  0K$   0K0$  $000 $011K,0S  $0  (0$ \1[ ,0000 0K  % 0S 0L0 $0$(  1[,0 ,00  0  0o$ 0$( 0S,0 ,0  $ 0S 0 %0,00 ,0 ,0 1[ ,00 0 %0KH-LMHI@8 < @ D0 8000 8000S(0K@   (0K0@   (0K0@   (0K0@  @00( K 8000S00K@   00K0@   00K0@   00K0@   @0000 K ]00 00 0Sn00 8000S$0K@  $0K0@  $0K0@  $0K0@   @000$ K !8000S$0K0@   $0K00@   $0K00@  $0K00@  @00 0$ K  00S $0S 00 8 0M 0S 0y(0S (0 S (0 S (0S<0 (010008@D 0 $(H-M000   0 0K= HH-MP00     4 0 000K<= H-M<00  , 0 0K< H-M00    '/O x 00,0S 0,0 3/00 0 0 0S 0 0 K 3/0Kx< H-M@@  000 0S B0|00 0,0S 0,0 3/000 0 0S 0 0 K3/7?OK; H-MX20  RD"0 R  0S 00| y, Rs!#%')+-/13579;=?ACEGIKMOQSt!0Vl!0Sd!0P\!0MT!0JL!0GD!0D,!0;$!08!05!02 !0/!0, 0) 0& 0# 0 0 0 0 0 0 0 0 0 0 0 0K: 0h0 000020K- pPH-M@@  00 0K/0S  H00 0S000(00 0K* $H-M(00  00K) H-M800   $ 0 00K) (H-MH00     ,  $ 0 00Kd) `H-M\00     0 00K( H-M000   0  0K( H-ML00   , $ 0 0y0K8( H-Ml@@  000 0@0K0 0 (0\$0K4  (,0 $0S(00S 0000   h0*$ 0S 0!$0S 00$ 0 0S 0$0S (00S@00>00K H-(M $ ( ,0 00 0 000 $( ,0R 0S 0I0S 00S 0000S 0010S02080S00 0K + 0S 0 0 00  0 0S $( ,0 0S 0  $ (00KH-$MC@ $ ( ,0 000 000 00 027S000S 000H0S 000H0 20s0S 029S 300024S ,0S0,0 200( 0S 0,00CSKIGFMDCBA@?*)<;:90 00CS) %020S" 00S  025S $0S000 #02<S 00 $ 0S 0W@10 0F0S 10$ 0B 0S 0300( 05 0S 0&0S $00 0S $0 0S 00 0 00 0S ,0 S ,0S ,0S U00K, DT,0XH-M A@  $0 000 00 1 0S 0+ 00r?@S @SS S S  S$0S p00(0S 00r?S(00 00KD H-M(00  0{0K H-M00     R l 0d0  RD 0Y000  00Kط <H-M   0 0S0S000  0S 00KH-4ME@0 4 8 <0 0000 0$0 0(0 $0KO/  0S (0KT  0S(00 c 0S(0, (0( , ,, (0( H @ H (04  (0   (000S(00 400cC10 00 0 (0  (0 (0  (0 (00   0S(0 0   0S(00   0S(0   0S00 !(0 010 !4 (0 010 (0 010 (0 00 000 014 00S(0 L <00S(00 20(00 (0 0 % 0Si$ $010$ $010$ $0t10$ $0\10$0(  $00  (00  $04    $ 80 00(0S 00(00S 7?Ok$0  $00   000$  $0 00 00(0S 00(00S 7?OM0K (0S1 (00S (00c(0 0S (0 00S (0 00(0 0P(00S (00G(00S (00>(0:$0S $030K蠶 hc8OXQQQH-(M( (00 0 000 0S 00S 0000S 0010S,0O080S0 0 0K  0S 0=00S 00H0S 00H0 2S 000 0S (00S00   0S 00 ( 0S  0S 0S00 0S 0  0K-$M  $0 00 0 0 00 00 0Ћ/-M  00 0 0 0Ћ/H-0MŸ ( , 0 40 (00 0 000 400 40<S 00SX20040<40 40S S,00 0S20 0w100p0S 00S 0000S 0010Sc0Y080S0$0 $0K  0S 0G00S 00H0S 00H0 2S 000 0S (00S00   0S 00 040 (,0 40  0S  0S 0S 00 $0S $0  , 0h0KX H-lMI@X \ ` d0 X00$0 $00(0 X00,0 d0000 d0<40 \00b?S T0K0  \00 \000S \0 ,0P00s0S,0P0 ,0P ,0 0,0 ,000S 0040 /  6?OR,00 ,0 ,0 ,00(  0S ,0Sp00 ,0 0100S ,0 0100 0S[,0 010 000 ,0L 0R,0000S,00 ,00 00 2,0 0100S,0 010 ,0 010 n 0S!,0 010080 ,0 ,000048   6?OR00C0 ,0 00 0SS0 0 G,0 0100X 0S,00000S ,0 010000S ,0 0100S,0 010 ,0 010 ,0  010 0S,0 00 00 0 ,0 0100S00 0 7,0 0100 0S,0 00 ,0 0100S,0 010 ,0 010 ,0  010  0St 00 0 ,0 0100S@ 6?OR,00 ,0 ,0 ,00(  0S) ,00(#  N0SH0 ,0L0R ,0 00 ,0 00 ,0 010000S ,0 0100S ,0 0108 Y 0S000 ,0L 0R 0S 0,0 0,0 400  0S 0},0P0 ,0P \00b?S 0 00(\o 0S ,0P0 ,0P 0]00 S0X`00r?S00 00 ,0X0 ,000 ,0000S ,000`00400 0 0S!  6?ORd0<S,0000S ,00000;S,00 ,0P0 ,0P 0S 0S,00 `0 ,04 `0 0K舫 H-(M( (000 (000 000 00 00 0(0S 0(0+0S 7?O(00S (00(   (0 0 (00(  0(0S 0(00S 7?O0S 00S 0000S 0010S%0w080S0$0 $0K 0S 0e0 0 .0 0100S 0 0100D 0S 00 0 0100S 0 0100. 0S 00 00 0 0L 0R$0S $0  00000 00000000S 000(0KH-HM 8 < @ D0 800 0 00S 00L100 D0S S; B00K 3000 000 K8< 0S30 K0 @3/ 0S 00 ,0@@@ 0S 0 0 000 0 000 08<@  00 0K$ lH-M  000 00 0 0K0S0K 0S 00 00cKH-0M  $0 0 0  $   K   0S 0M 0; 0 0<S 0S 00;S 0 8!,8! 0;S 0S 00<S 0 8! 8! 0< 00 8!+8!0  0  $ 0  (   00 > 0 0S 0S00 0KH-M00   , R  ,   0 Rx  l   0 R  0 @   O0 0 0G7?OKH -M 0 0 00 000 00 0 0R:0Ћ/H- M  $0 00  0KH 0 K0 0 020s0S 000s 0 0  $0s 0 KH-MF@` d h 000 `000 00 0 0$0$0 0L0 00 0T0 T0 @ K ` 0 0S]`0 `00TK0K$ 0SP00 0(0 000Sd09S h0 N00 00T0 T0(0 0H0 0D0 00 .000T0 `0 `00TKLK$ 0S$L000 L H0K00 L00S 0, L00L  0.d09d0 `00S9 `000S4 `081<S/`000S `000H0S `000H0 20S`0 000T0 HK d 0f 0S 00 00  00  0S`0 `00TK LK$Z 0S00T  L0 L0  L0T  L00 `0 0 `00$ 000 @0S @0K`00,0 ,0S 0S,00 0Sd00CSL L00 d0L0L   L0 L0  L0 !L0  r !L0  L0d r  0S'0X0 0$X KP0K  0SIX0S PP0 X01C1 t0$X0 CP0K a 0S1d0S `081 0S`0027S `00S L00 @ K ` 0 0SL h0 0* L0S `0 L `00$ 00S `0 0 `00$@0S @0K`0KL H-M  00(0 (0$0,0 00 080 00 0 0 00 0$0 00 0 K  0h 0S`0 00K8K,L 0S80 0 0 8000 800 K0K, V 0S0S| 0 0RL 00 0S 0 0K0S0 00R 01000 0 0K,  0S 0%0S 0010 0 0 0 0S 0R 0 0010 00c  y0 0 +0S( 00C10 0 00C 0 00 R 00C 0 0 R*0 R:00 C 0R0$0 80 0 0 0S0 008K, 0Sd800 00 0 00KK, 0SR000 00 00S 000S 081<S000S 000H0S 000H0 20Sp0K 0p0 (02<S (020s0S 00@0l0 00 0 0R$0S00 000C SG ;46?>01S7 l 0100l0 010T0 (0 010cP0 00   p K    T K ( 0 0S-  $081<S9$000S $000H0S $000H0 20S&d0D0 l 0001@0 0\0 0X0 $0 (0(( \K DKp 0 0S T(0 (0  $ d0( (lK x 0 0S9l0S(0  (0d   0S (0 0 0S (0 l0 c0 l0S 0S d 0 l  0 0d0  d0S d0(0S $0 ( $00 0S 0S 0 0 T0S $ T0Kv00 0 0S 0S 0 0 $0- 0S 0S 0 0 0KH-tMX \ ` d0 X000 0$0 0 0P0 0H0 0S d 00C1X0 X00HK  0S X00S X000S X081<SX000S X000H0S X000H0 20S0 0 c0001 P0K G 0SP00 d 0100 )0 0 X0 X00LK i 0SL 00X0 L0  0 0S0 00 000 d 01 0RP0<0  0 c000180 0D0 0@0 H0S X0 \0\@\HH\ @ <K 04 0S# |X0 \0\\\ DK <K 0 0S `\0 \0  H0S H0\ X0 0 ` 0[ 0S?0`0 X0 d0100  0 0S/d 0100 C\0 0S\0  H0  X0 H X00 , 0S0H0 d0K  3 P0S 0 P0o`0S X0 X00 ` H0S X0 H X00 0KH-8M0 0000 00 0 00S 0,0 00 ,0K  0KH-M  0 000 000 000 000s0S<00S8 0$00T0S 0S 00S 000:S%0810S 081<S 0S00S 00H0S 00H0 20s0S0S 081 0S 0 0/0  00S 0 0 00000S 0000S 000081<S 0S00 081<S0S 000S 000 0S 0S00S00 000S 0S00 &0810S 0 0S00 081<S 0 0S00 0027S 0 0S00 00 00 0S! S 0S0 00 0|0 0p0 0lK0x0 000 0S 00w K 00 o0K0  w0"K 0  000 0S 081<S0$00t0 0S 0S w0"K 0  g0"K  0000 0 |0KK 0S 00C2| K 0R0S0l0K 0C g0K00S 6?OR00 0 6?OR001:S 06?OKH-`MX \ X0027S \0 0S00 X00S00 X0810S \0 0S00 X081<S \0 0S00 00 X000 0S S .\ -0P0 0D0 0L0 \0@K000 \0 KX0 P0KTK  0S T P0K 0R\0@0K0 0 0KH- M10    R    R  R R D!00H0!000 !0 `0;0S( 0S 00S 0000S 0010S0 080S00 0K 0S 0 m 0S 0S 0  0Kl 8dtH- M  0 0S0K 0S 0000 00 0 000 0K). 0Sj0   0  0  0S]0H0S 0H0p0S 7?Ol0L0 0L 0H0S 0H00S 7?OX 00S 00H0S 000H00|000 0  00S 00H0S 0H0(0000h0S0$0 0S 0  0 00S 0$0S 0$00000S 000KH-M40   X h           "  H4 <8 0< $@ D  H l L P T X \ d h l p t |x p| d X L @ 4 (               t h \ P D 8  ,   ( , 0 4 8 < T X \ ` d 0h2 0S 0 0S 07 0S 0 0;S  0S 00KHh HT$lxPDУԠ 0$8СHlx ,80d4|PXht88@Td\H-M00   r R  " r R  R  " R  R  " R  R  " R 0" 0 0"0   00K`b -H-M  00 00S 000S 00   000 00S 00 0S000S00   0KHЍ/-H-M 0 0 00S 000S 00   00 0 00S 00 0S000S00   0KH Ѝ/H-Mt00   ")R   H 0 0023S   0 0K_ H-M00    ")R   ` 0 0 0S 0, 0 0S 00 0 0K_ - M 00Ћ/- M 0$0Ћ/H-M00  ")R   d 0 00 0S 023S 0T0S00K^ - M 022S00Ћ/H-Md00   ")R   8 0 ~00 0 0K8] H-M00   ")R   X 0 ^0  i 0S 00  0K\ H-Mx    0 0000S00@00%000  00K\ (H-M    0 0000S00|000029S 00D00 000  0B0K[ <H-M00   ")R   | 0 0 0S 0  0S 00  0KZ PH-Mh00     R  8 0000 0KY `H-M(10      R   0{04 ")R    0 {0%00 7 0S 0000 0 0000S  00   3/ 0S 0i0KlY xH-M  00 KH-M  00 KH-M  00 KH-M  00 KH-M  00 KH-M  00 mK- M  0  0Ћ/-M   00 000S 00 0 00 0 000s0S 00<0 000 0 00<S 00)0 00,0 Ћ/H-MA@ $ 00 00 *00  K0K   K0K   K0K   K0K   0"0 0R`00 1 00 000 800 10 0S$0  0KU H-MdA@  000 00s0S 00S$100@0<S 00S00+000? K L0K 0S 00K. 0S 00K 0S 0 0S 000 +00KT H-M  00  W7?OR R023S 04 0 023S 40 000KH-M00   ")R    0 000  W7?OR R 02#0"02#0"00KR H-M    0 0000S00|000029S 00D00 000  00KQ H-M  00 TKH-M  00 RKH-M  00 K- M  0 0 0Ћ/H-M10   ")R    0 60- !Q    0,c0 R   x 0(V0 B  R   < 0G00  0KP 8`H-M  00 0K- M  0  0Ћ/- M  0 0 0Ћ/H-4MXF@ $ ( ,0 000 00 00;S 00 0 00S 02' 0" 0<S 02' 0"(0S (000S 02" 0" 0 ,0SE0S6 00S\500N 02+ 0" 02 0" 0 0S 5009 00S 0* 00SB 080  0S8 0" 02+ 0" 0$0 *0S0S00 000K0 $( ,0b 0S 00000 00 $( ,0k 0S 0 0T000S 020S 09 000 00 (, 0j 0S 0 02;SS 0S00 $( 0p D00 00 000K0 $( 0 0S300S/ 00S 00H0S 00H0 20S00S 00L0@0S 026S(0S 027S 0P0 0 ( 0 0St 0 00CS< !-00 00 $( ,0 ,00 00 $( ,0\ !00 00 $( ,0E 0000 00 $( ,0 0 0!  050S0 026S,,0S0S& 0h0S" (0S (000S  0h0 X (  00S 0h0 0 0KDN H-Md00   ")R   8 0 "004 0 0KG H- M    0 0 00CS 00 0 00 0 00 0X 0 0 0\   00 0S0S 00 0KHG (H-(M   $0 00 020S20$0 0 0T0  K $ 0 0SG0 0   00 $ 0S 0S00 0S+00 )0 00CS $ 0 $ 0 00 0 0 04   00KF HH-PM8 < @ D0 00 0 0 @000s0Se <0S <02 <0"@00S000 @0{?0 00$0 D00s0ST 0 0 800@  ,   8 0W 0SA 0S 0S 0(0K$ K (0K0$ K (0K0$ K (0K0$ K $0K( K $0K0( K $0K0( K $0K0( K 0 0 0$  <0S <02 <0"800S D00S@ 0K@0 0 0 0S ,0K K ,0K0 K ,0K0 K ,0K0 K 0K, K 0K0, K 0K0, K 0K0, K 00K K 00K0 K  00K0 K  00K0 K  0K00 K 0K000 K 0K000 K 0K000 K 40K K 40K0 K 40K0 K 40K0 K 0K4 K 0K04 K 0K04 K 0K04 K 0S" @S S" @S S b! @S a% @S800S  0S 0!0 0 O800H0S 800H0 20S0S0S 0S0S 0K8< * 0KH-$ME@ $ ( ,0 00 $023:$ 2,0 00 0S" @S S" @SS S ,b! @S a% @S$0 $,  0SR[$023S 00S 00L0@0S 00L00S,00S 0$023S0K K 0K0 K 0K0 K 0K0 K 0K K 0K0 K 0K0 K 0K0 K $02#$0"0s 30( 0S" @S S" @S S b! @S a% @SZ $0 0S $0 0S $0 0S,0000$023S+ 0K 0K0  0K0  0K0  0 K 00 K 00 K 00 K 00S $0 $0 09SL,0$(  0SE 0o$0 0S $0 0SP$0 09S6,0$( 5 0S/ 0U$0 0S $0 0S8$0 09S ,0$(  0S 0;$02*$0"$08 ,040 S 0 $026S 00  800( 0S 00K> pH-@M0 4 8 <0 000 0 00$0$0 <00 0S <000  0R00 <0 00cR 00c0 <0 00 00 00 <000SX<00<S <0 0RO*<0  6?O<000S <0  0( (0S; (0<00@0S <0  ?( (0S+ (00S 00S 0 0R*  ( (0S (00  0 <0 0S 0 <0 6?O<0  0 0 <000 0 , K $4 80( (0S (0w,01 0 0RZ:,010K,0 002<S 0020s0S 00@000   0R  00c 00 0s 0s00cs 0[00K [0R00K<000S 0<0 0 c0[< 0[0000|x ",R x " r R  @ [  0bs00C1K01K`0K020 `0S \ `0R `00"  `000\0 \0`0 0X0 D000 1[ 0H0 n0K \000 `0K0X10 6[` K0 26[0 00  H0R:D01[S1[S40s00| x02<S x020s0S 00>0[000|x ",R$x " r R   4\l,@LPx@ [  0bs00Cs0` K0 Il0KD d0h` K0  X`0S \ `0R `00   9`000\0 \0`0 0X0 "`0S \ `0R `00!  `000\0 \0`0 0X0 D000p!  0$0 ,0L0 x026S L00` K0! L00L  ` K0! L000S SSL0 L00`K0S+L0 0` K0 b#`0S \ `0R `00t"  `00n0\0 \0`0 0X0 L0000"  0$0 ,0P0 P00P ` K0# `0Sx \ `0R `00<#  `00<0\0 \0`0 0X0 c,0T0 T000S SST0 T00`K0)`0K0T #`0S \ `0R `00$  b`00 0\0 \0`0 0X0 T0000X$  O0$0 $`0S \ `0R `00$  <`000\0 \0`0 0X0 |000$  *0$0 1[01K|01![R:$0 K0H-$MlB@ $ ( ,0 $P20 ,0,0Si $,20 ,0S0,0 00 00 (00 ,00 D0 00000@0S00 S 00 S 00C0 000 0S0S(00 ,00 00 $ 0Sz  6?ORX0?0?0X0 X \0K \ 0SX0T0  6?OR00  0S 0S 00 $0s 0S 0S 00 \0S \00K H-M@D@  0 0S 03/ 0S 00ST 00 K f30 0Kd90S70K00 0K0 0K0 00#2s0p#  0 000 000D#  0 000 000 0S00s0  B S0 K03/  K03/ 0S 00Sd 000 000 R$0 00000@0S# 00\S 04" 3/ 0S 0~20 00Kd K03/ 0S" 0j10 00#2s00Kd K03/ 0S 0I000 0S00s0  B S4000 000 #00 00#2s00Kdn K03/ 0S 0000 0S00s0  B S04  3/0K  HH-dM0N@X \ ` d0 00 0P0 0 0 X0S00 X000 0S D0K   0S 0g 0X00s0S 0`0 00 0D0 00 X0S00 #0S D00 S S S D0<0<S 00 00 00 00 00 X0 00 0, 3/ 0S`0S 0, 3/ 0S 0d, 3/ 0S@0 0 P0K  6 0S\0S( P  <0  ᮿP 03/ 0S@0K \0@0 \-0<0 @0K   0, 0S00CShO0@+ 3/ 0S0S D0<00S00T0 H0KXK 0S :0 ڼX026S00T0 T0S 0* 3/ 0S[0S D0(0L0 L0KX½ 0S 0:0 ᰼dL0S L0S P:0 L0 &P 03/ 0S L0) 3/ 0S%0S D0,0L0 L0KXc 0S \90 x,L0S P<90 L0 P 03/ 0S0S D000L0 L0KX 0S 80 NL0S:P80 L0 ǾP 03/ 0S+ 0T( 3/ 0S0S 0<0L0 L0KX 0S 70 P70 L0 啾P 03/ 0S0S 080T0 T0KX 0S `70 T0S T0 S P470 T0 hP 03/ 0Sz0S 0D0L0 L0KXD 0S 60 ŻyL0S P60 L0 >P 03/ 0S d0L& 3/ 0SG0S D0<0;S00T0 X025S00T0 T0S 0% 3/ 0S*0S D0<0<S00T0 X02;S00T0 T0Si 0S D0$0L0 L0KXX 0S 50 \P40 L0 ؽP 03/ 0S0S D0 0T0 T0KX% 0S l40 5T0S+ T0 S* P@40 T0 嫽P 03/ 0S  40  0S- D0<00S 0|# 3/ 0SD0<00S 0D# 3/ 0SD0<00SO 0 # 3/ 0SE X020s0S 0" 3/ 0SkX020S 0" 3/ 0S^X02<S 0P" 3/ 0SQX028SP20 X00 P 03/ 0S<d0S 0! 3/ 0S10! 3/ *(&$"  0S D0  $ $0S 0S$00 P0S P0K0Kl (4@P\p  , < H T d p H-M000  02/0K H-M`00      D 0 q@0T 00K` - Mp00   BRD 0 < 04 0, 0$ 0Ћ/ T  H-HM8 < @ D0 000 000 0$0 0,0 0(0 00 0S 000< ( K$K8 0 0S  N7?ORl00 \( ,0K i 0S],0, 8!,8!(0$00 $00 0 K  0㢹 0S  6?OR4 ( $00 . 80 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $0\0R 00 $0\0R*0000 $0`0R 00 $0`0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0\08 w 0S D0S D0S$00S 0SCD0S D0S=$00S9,0 00K    0 0S ( 000 傹 ,0$0$0 $0(0S $0$ $0D0S $0@00 0 0ι 0Sh0 0 >0S D0S D0S$00S 0S.D0S D0S($00S$,0 00K    0㪽 0S ( 000 . 8,0$0 $0 0  0S*0 0 0S D0S D0S00@ 00$ \ 0 ,00 0S 000 $ @0 00 00S 0 ,00$0S $08$,0S ,0ᆻ 0S 0S 00 0KH-HM8 < @ D0 000 000 0$0 0,0 0(0 00 0S 000< ( K$K8 0 0S  N7?OR00 (0$00 $00 0 K  0 0S  6?ORM ( $00 偸 n0 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $0@0R 00 $0@0R*0000 $0D0R 00 $0D0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0@08 ʾ 0S D0S D0S$00S 0SdD0S D0S^$00SZ(0 00K    0Q 0S ( 000 շ 00$   00$  00$   00 !00(  r !00  00  00$ ( r !00 !0 (02<S (020s0S 00@0$0$ $0(0 ἶ00$  0 0 30S D0S D0S$00S 0S#D0S D0S$00S(0 00K    0ܻ 0S ( 000 ` M0 0 0S 00D R D R@ $ @ 0 (00 000 0S($00S $00S  $00 0 K  0㏶ 0S  6?OR ( $00  0 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $0H0R 00 $0H0R*0000 $0L0R 00 $0L0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0H08 d 0S(D0S D0S"$00S(0 00K    0 0S ( 000 | i00$   0 0 *0S'D0S D0S!$00S(0 00K    0̺ 0S ( 000 P =00$   0 0 0S 00D R D R@ $ H 0 (00  000 0S000 $0 0S $0 0 0 K  0} 0S  6?OR ( $0 0   0 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $0P0R 00 $0P0R*0000 $0T0R 00 $0T0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0P08 R |0S#D0S D0S(0 00K    0 0S ( 000 n [00 0 0 &0S#D0S D0S(0 00K    0ù 0S ( 000 G 400$  0 0 0S 00D R D R@ $ P 0 (00 000 0S000 $ @0 00 00S 0 (00$0S $08A,0S ,0᣷ 0S 0S 00 0KH-@M0 4 8 <0 000 0(0 00 0$0 0 0 00 0S 0004  KK0 0K 0S N7?OR0 0 0$00 00 ( K  0 0S 6?OR 00 垴 (0 00R (0 00R*00(0 0 0R (0 0 0R*0000 <0S <0S-0S*(00S(00S (00S(00S000S 000H0S 000H0 20s0S (0 000 }0S+<0S <0S% 0 (0K    0㣸 0S (00 ' \(0(   r  r !(08 780 (00R180 (00R+<0S <0S% 0 (0K    0k 0S (00  $(0(   r  br !(0  (  00崽 0(0 0S 0(0  80 0 0 (0S (  00嚽0S 00$0S $0[ 0S 0S0 0 0KH- M  $0 00 0 0 00 0 0K > 0S 0  0 00 0S 0Ὰ0KH-@M0 4 8 <0 000 0,0 0 0 0(0 0$0 00 0S 0004 $ K K0 0ቺ 0S N7?OR0 0 $0$00 00 , K  0㞲 0S 6?OR $  00 * 80 ,00R 80 ,00R*0080 ,00R 80 ,00R*0000 ,0 00R ,0 00R*00,0 00R ,0 00R*0000 <0S <0S-0S*,00S,00S ,00S,00S000S 000H0S 000H0 20s0S ,0 000 u Y0S"<0S <0S$0 ,0K    0 0S $ ,00 呲 8,08 %0S"<0S <0S$0 ,0K    0 0S $ ,00 k ,0  , $009 0,0 80 ,0S , $00( 0S 00ᇹ(0S (0 0S 0S0 0 0KH-XMH L P T0 000 040 080 00 0(0 000 0,0 00 0S 000L , K(KH 0ᙶ 0S  N7?OR00 ,0$00 0<0 <0K 4 K  0S 0S T0S T0S, <0 ߱ P0 400R P0 400R*00P0 400R P0 400R*000 0 40 (00R 40 (00R*0040 (00R 40 (00R*000 0 T0S T0S- 0S*400S400S 400S400SH00S H00H0S H00H0 20s0S 40 (00H * R 0S0T0S T0S*,0 40K    0µ 0S , 400 F 140P 40( 0  (0( 40 0R:40( ( 5 0S2T0S T0S,,0 40K    0㎵ 0S , 400  40(  (0 0S(0$0S 40( (  40( 4 T0S/(0 0S(0$0S' D K@0K j 0S@0S D0 @0K ɮ 0SD0S @0@ D01 ó@0( ( (0(0 8 K  0! 0S( T0S< T0S9 (0(0 8 K  0  0S T0S T0S0S  , (0(0 唰 00 P0 800R P0 800R*00P0 800R P0 800R*000 0 80 (0 0R 80 (0 0R*0080 (0$0R 80 (0$0R*000 0 800S800S0 0 T0S T0S- 0S*800S800S 800S800SH00S H00H0S H00H0 20s0S 80 (0 0H Ӷ T0S T0SJ 0SG,0 80K    0k 0S , 800  (0,0 S #`00S 00 00 80( (  80 80  80 !80,  r !80 r  80( , r  80P CT0S T0S= 0S 0S7 ,0 80K    0 0S , 800 囯 80( (  80 80( 0  80 !80,  r !80  80  80(  80S 800S1800S-(0 0S)(0$0S%T0S T0S80S 80 02 0S9080 40 (0(0R (0(0 0Ҵ 0S(80S 8 ,00 080 0S4 ,00 040 0S( P0 00 80S 8 ,0040S 4 ,00۸(0S (0H:00S 00ᜱ$ $0S 0S$00 0KH-HM8 < @ D0 00 00 0(0 @0 0S000 @0 0  K < 0, 0S  6?OR @0 0D 幮 G@0 0S 00 0 00R 0 00R*000 00R 0 00R*0000 0 @00R 0 @00R*000 @00R 0 @00R*000 0 0S 0S- 0S*00S00S 00S00S800S 800H0S 800H0 20s0S 0 @008   0S9 0S 0S3D0 0K   < 0㖲 0S 00D  @0 @0D0R0@   B 0S 0@   @0 0 0 :0S7 0S 0S1D0 0K   < 0Y 0S 00D ޭ l0S 0 @00R*0@  0@ @  @0@ 0 0@  0S 0S @0 0D 嵭 C 0S 0S 0S) 0 @00R#*@00 ( K < 0 0S#  6?OR0S 0S 0S0 @00R@00 ( K < 0٬ 0S@0$0$ K <(00S(00S! 0 (00R 0 (00R*000 (00R 0 (00R*00000 (0 $0R (0 $0R*00(0 0R (0 0R*000 0 (00S(00S0 0 0S 0S, 0S)(00S(00S (00S(00S800S 800H0S 800H0 20s0S (0 $0K8 ᨳ s 0S 0S 0S$ $0S 0S(0 @00R (0 @00R:(0 @00R (0 @00R*00s0S 0S$ 0 @00R@0D @00R(0< 0{ 0S!0(0 @00< 0! 0S@0D @00R2D0 (0K   < 0 0S (00D r (0  (0 (0  (0 !(0 !(0  (0  (0 (0  lD0 (0K   < 0㺰 0S (00D ? (0@   (0 (0@ @  (0 !(0D  r !(0  (0  (0 70S4 0S 0S.D0 (0K   < 0| 0S (00D  (@0$ @0(0 0S ( (01@0H @0L0 (0S ( D00<幵 0Sc0(0 0SD@0 @0D0R> 0 K,0K I 0SP,0S1 040 0S@0,0 40K⚪4 00R*, 401, 4001 0400c1C1 ᘮ00 C,0K ᇩ 0S#0S  D00<b 0S00 00  (0S ( D00<A0S  D00<80KH-@M( , 0 40 00 0 00 0 0 00 00 0S 000,  KK( 0 0S  N7?OR00 0$00 0 004 ( 2  00 0S 0(M 0S 0ᯭ 0S 0S00 0KH-@M( , 0 40 00 0 00 0 0 00 00 0S 000,  KK( 0! 0S  N7?OR00 0$00  004 (   00 0S 0( 0S 0P 0S 0S00 0KH-,M@@( , 0 40 00 00 00 ,0 0K( - 0S 0(000S 00 (@004(O 0(ᩱ0Kx < H-PM@ D H L0 000 0$0 0,0 0(0 00 0S 000D ( K$K@ 07 0S  N7?OR]00 S(0$00 (0$00 $00 8 K  0ㆩ 0S+ L0S L0S  6?OR2 ( $00   1$00 8 K  0c 0S ( $00  $004 K 㽰H0 800R H0 800R*00H0 800R H0 800R*0000 80 40R 80 40R*0080 00R 80 00R*0000 L0S L0S,0S)800S800S 800S800S@00S @00H0S @00H0 20s0S 80 40K@ = 0SOL0S L0SI800 S 0 0 (0 0S00 0 (0 80K    0ƭ 0S ( 800 J o808   80 80  80 !80(  r !808  R  r  80 r  80H 90S6L0S L0S0(0 80K    0キ 0S ( 800  +8$0 $00 $080S 8 801$04 $080 8 (00 0S$ H0 $0S $0@,0S ,0t 0S 0S 00 0KH-`MH L P T0 000 0 0 0(0 0$0 00 0S 000L $ K KH 0y 0S N7?ORL0 0 ,$ (0K 㛦 0S=(0( 8!,8!$0$00 0000 04 : :J1@0 T0S T0S 0,040 (0@ K 4 K P    08 0S 0 0SK 0 0 , K  0㫧 0S7,0 0$0R$,0 0(0R(0 ,0K    0㝬 0S $ ,00 ! ,0  ,0P , $00 0S0,0  6?OR 00 , K  0_ 0S,0 00RO,0 00RH(0 ,0K    0Q 0S $ ,00 է  0 0S @0S,0  ,0   ,04  ,0P 00 u0 0 K  0 0SX000S000S 00 P00RL00 P00RF(0 00K    0 0S $ 000 偧 9@0 C0001  0R040 0 0040 00   00 004  00 !00$  r !00  00  00  0 $00% 0S0 00 @ 0001  0R 0 0SM 0 0 , K  0㎦ 0S7,0 P00R&,0 P00R (0 00K    0〫 0S $ 000  ,0   ,0 $ , $00ΰ 0S 6?OR0,0 00 , K  0@ 0S,0 P00R0,0 P00R*(0 ,0K    02 0S $ ,00 嶦 n,0 , 0 0S,0   ,0  T0S1< K80K  0SI80S$ < @0 80K v 0S<00 8<0! 0<0 0 00 @ 0001  0R, $00A 0S P0 0 0   0S 0H(0S (0 0S 0S0 0 0KH-TMTK@H L P T0 00$0 0<0 0@0 00 000 080 040 00 0S 000L 4 K0KH 0ѧ 0S N7?ORy0 0 k40$00 0D0 D0K < K $ 0I 0S T0S T0SR4 D0 ե UP0 <00R P0 <00R*00P0 <00R P0 <00R*000(0 <0 000R <0 000R*00<0 000R <0 000R*0000 T0S T0S-0S*<00S<00S <00S<00SH00S H00H0S H00H0 20s0S <0 000H 0S0T0S T0S*40 <0K   $ 0㸩 0S 4 <00 < <0P <00 0  00( <0 0R <00 ( (0ST0St T0Sq 00(0 @ K $ 0w 0S" 00(0 @ K $ 0h 0S T0S T0S 0S0 4 00(0  p00 P0 @00R P0 @00R*00P0 @00R P0 @00R*000(0 @0 00 0R @0 00 0R*00@0 00$0R @0 00$0R*0000 @00S@00S 00 0S 00$0S @00S@00S00 T0S T0S-0S*@00S@00S @00S@00SH00S H00H0S H00H0 20s0S @0 00 0H  T0S T0SJ0SG00,0 S #`00S 00 00 40 @0K   $ 0㧨 0S 4 @00 + @00 (  @0 @0  @0 !@04  r !@0 r  @00 , r  @0P CT0S T0S=(0S 0S7 40 @0K   $ 0c 0S 4 @00  g@00 (  @0 @00 0  @0 !@04  r !@0  @0  @00  @0S @00S@00S00 0S00$0ST0S T0SHd10jHS @0S @ 400$u 0S0@0 < 400$i 0S 0<0 0 P0 0 0 @0S @ 400$O<0S < 400$F00S 00Hᥪ80S 80, ,0S 0S,0 0 0K輅 l H-@M0 4 8 <0 00 0(0 00 80 0S000 80 0  K 4 0㕢 0S 6?OR 80 0< " [80 0S 00 0 00R 0 00R*000 00R 0 00R*0000 0 800R 0 800R*000 800R 0 800R*0000 0S 0S-0S*00S00S 00S00S000S 000H0S 000H0 20s0S 0 8000 g 0S: 0S 0S4<0 0K   4 0 0S 00< 儢 0S08   80 0 0S 0 00R*0  0 =0S: 0S 0S4<0 0K   4 0 0S 00< F 0S08 @  80@ 0 08  0S 0 800R*08  0S 0S 80 0<  S800 ( K 4 0q 0S?80$0$ K Ԩ(00S(00S! 0 (00R 0 (00R*000 (00R 0 (00R*00000 (0 $0R (0 $0R*00(0 0R (0 0R*0000 0S 0S,0S)(00S(00S (00S(00S000S 000H0S 000H0 20s0S (0 $0K0 J 0S 0S\0S$ $0SV 0SS(0 800R (0 800R:F(0 800R (0 800R*00s0S4 <0 (0K   4 0㽥 0S (00< B {(08   (0 (08 @  (0 !(0<  r !(0  (0  (0 70S4 0S 0S.<0 (0K   4 0 0S (00<  =(80$ 80(0 0S ( (0180D 80H0 (0S ( <004弪 0S0(0 0S  <004孪 0S00 0 0 (0S ( <004喪0S  <004卪 0KH-@M( , 0 40 00 0 00 0 0 00 00 0S 000,  KK( 0ᾦ 0S  N7?OR00 0$00 0 004 (   00 0S 0(ᢧ 0S 0 0S 0S00 0KH-@M( , 0 40 00 0 00 0 0 00 00 0S 000,  KK( 0ѥ 0S  N7?OR00 0$00  004 (   00 0S 0(C 0S 0ᥢ 0S 0S00 0KH-HM8 < @ D0 000 000 0$0 0,0 0(0 00 0S 000< ( K$K8 0 0S  N7?OR00 (0$00 $00 0 K  0 0S D0S D0S( $00 域 $00S 00 $00R 00 $00R*0000 $0 0R 00 $0 0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $008  0S"D0S D0S(0 00K    0㠣 0S ( 000 $ w00@ 8@0 000R2@0 000R,D0S D0S&(0 00K    0q 0S ( 000  H00$ 0  00$ $ 00$  0 (00幨 0S*000 $000 0 K  0/ 0S D0S D0S( $000 庞 0 0 @0 000R @0 000R*00@0 000R @0 000R*0000 00 $040R 00 $040R*0000 $080R 00 $080R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0408  $00S0SD0S D0S $00S'0S$D0S D0S(0 00K    0㊢ 0S ( 000  a00$ $ 0 0 7$00S0SD0S D0S $00S&0S#D0S D0S(0 00K    0Q 0S ( 000 ՝ (00$  0 0 0S D0S D0S00$ 4 00@ 0 (00叧 0S000 $00S $0$0 0 K  0 0S D0S D0S( $0$0 匝 0 0 00 $0(0R 00 $0(0R*0000 $0,0R 00 $0,0R*0000 D0S D0S-0S*000S000S 000S000S800S 800H0S 800H0 20s0S 00 $0(08  0S$D0S D0S(0 00K    0㏡ 0S ( 000  f00$ 0  0 0 /@0 000R)@0 000R#D0S D0S(0 00K    0^ 0S ( 000  500$   0 0 0S D0S D0S00$ ( 00@ 0 (00圦 0S000 $ @0 00 00S 0 (00|$0S $08ۣ,0S ,0= 0S 0S 00 0KH-,M$A@ $ ( ,0 00$00 00 0 00$KKћ 0S 0*00$0 ( 00R01S 0$0  0K( , 0[0000l  ",R  " r R "  B [  0bs00C1Kl0 l002<S 020s0S "00B0[0000$0 00K00 0 0[0$ 0^ K n%[0[0s000K [1[R: 0 l00ᶙ00[00K [0[RV:l0 0S 0 0Kh0 h00hlK匞 0S 0t0 h00S_ h000SZ h081<SUh000S h000H0S h000H0 20SB\0K @0K l0\0 02<S 020s0S 00@0X0 X l0100X0 l l010@0 0 l010c<0 h0 l0l\K@K 0L 0S 0Sl0 l0  l0l   l0 l0  l0 !l0  r !l0 [ R  r  l0 [ 0 l000't00S l0hL 0S 0h0 l h00? 0S 0t0 0KH-8Mğ ( , 0 40 0 0 (000 00 00 0ST40 Ğ0 840 < 0S 00S 00S 0000S 0010S{0080S0$0 $0K  0S 000S 00H0S 00H0 2S 000 0S Ț 0S 00 `0<S ,0S0010s0S 0:S $ ,0K 3 0SA00 ,0S 00S 000S ,000S ,0<0 0K | 0S $ ,04 00 0S 0 h 0 X ,0S 0 X 0S ,0 0埚 0S 0S0 0 0S,0S 0S$ 0 % 0S 0S0 0  0S ,  0 ٖ 0S 0S0 0 0S O 0S 0S0 0 $0S $0  0KlR H-0MhŸ $ ( ,0 00 0 029S 020 㙝0 20, 0Ơ 0S 0u  0ҡ 0S 0j 0S 00S 0000S 0010S E0S 080S00 0K  Ν 0S 0A 00S 00H0S 00H0 2S 000 0S  0ї 0S 00 0(  ,   $0F 0S 孛 0S 0S00 0S 0  0KM H- M   0 0000 0ҟ 0S  1 0S 0S 00 00  0S 0S 00 0KH-(Mß   $0 00 0 00 00 $0S 0S 2000 $0S 02+0"0$0 C00 0S 00 $0D w 0S 000S $ 0 h02;S 000K0 $ 0㖝 0SQ02;S00s0S  0K  ㄘ 0S0  㴕0 0 0S00p2S 0p“$ 000004( ",R ( " r R  @   0bs00Cs00 00 0 @4 4(02<S (020s0S 00@000000 000S00 0 00 0 000 0(,0 0ɐ0000 00 0 (0 400ޏ0 (00    0:0KH- M   0 00 00 0S 00 00 0 0R *00 0c0 0 0R*0 00 00 000S 0  0S 000 0Kl K )>K0l K )>K0l K )>K0l K l0K).K l0K0).K l0K0).K l0K0).K l0K /K "0> 0S<24 0K " 00夗 0S- < KX0K 0㚍 0S  6?OR00   0S 09 0S 0S00 0S 0 A 0S 0S00 \0S \0 0S 0S00 t0S t0᠔0K$) h l H-(M(20 $ (   R !0 ʒ0s( R ( R !0 ȕ0e 0S 00S 0000S 0010S 倍0N 080S00 0K   0S 0< 00S 00H0S 00H0 2S 000 0S ͎000 0S (00 $  0S  0S 0S00 0S 0  0Kp" H-DMA@( , 0 40 0K( ㍑ 0S 0g40S 0I 0SJ0   )  , 004 0S ($10 00嵋10$00 0$0  0 0  0, 0U 0S$00$0 $0K K , 0͋ 0S  6?OR00 0  0S 0S00 0K, - M 0 S%00@SC00S00 S10 S 20 S40 S80 S00 S?0 S?0 S00S00@0S?0@0S00@0S?0@0S?0@0S? 0@z0S?0@t0S00@n0S0 0@h0S?/0@b0S??0@\0S?_0@V0S 00@P0S00@J0S?0@D0S?1@>0S?1@80S03@20S?3@,0S?5@&0S08@ 0S0<@0S120S08A0S.2 0S20S 1 1Ћ/-M  0 0 00 0 0  000 00 0  0R:Ћ/H-0M,Ÿ $ ( ,0 00 0 029S  0010 㺐0q , 0S 0h 0S 00S 0000S 0010S u0Q 080S00 0K   0S 0? 00S 00H0S 00H0 2S 000 0S  0 0S 00 0,  $ (0 0S ߎ 0S 0S00 0S 0  0K< H-,MDA@ $ ( ,0 000 0,0K $( 幈 0S 080<0 0 00CS 0, t 0,  0, > 0 0X   # 0 0S 0S00 0K H-M\00      ,  R0 0 ݒ0K H- M(20 $  ")R   !0 㴏0r !0$ 0 0S 0e 0S 00S 0000S 0010S k0N 080S00 0K   0S 0< 00S 00H0S 00H0 2S 000 0S  0 0S 00 0 $  0S ؍ 0S 0S00 0S 0  0K 0H- 8M@@8 < @ 0KI80P K00K80|   /@00S 8@e 0S 0 8<@   0S 00 K0 H-,M$A@ $ ( 000 0K $ ~ 0S 02 0 00CS 0(ҋ 0(: 0(! 0 0X    0 0S 0S00 0K H-DM$G@@ D @000 700'  ᯒ60᪒@00&  60ࠒ@00S6060&  60@0 0Sl60d60\&  T60~@00S(60 60&  60m@00S5050%  50\@00S5050%  50K@0 0ᰏ 0S 0d50\%  P507@0(0<%  D09@0,00 0S 040$  40@0000 0S 040$  40 @040$  40@080p40 a@0L0 $  H40@0T0#  $40@0X0S @0X00#  30Ց@0\0S @0\00l#  30Ƒ@0d0S @0d000#  |30ෑ@0x0#  X30୑@0|0S @0| 80K᥏0 30#  ᙑ@0 1S2020"  20@01SP20H20@"  20w@0 1S 2020!  P20f@0$1S1010!  20U@0(1S10|10t!  10D@0,1S@108100!  103@001S0000   P10"@02 8!   $10@0P0S@0P0St00l00d   00@0P0ᮈ@,0K d    , 8 D P X ` h p  4 H X h H-M B@ 000 200"  Ṑ10ᴐ00 0(0S 0 0(0=0S 7?O_10ᜐ 000 ^ 0S 0S00 000 0S,10႐ 000 D 0S 0S00 000 0S00h 000 * 0S 0S00 000 0S 0(0S 0 0(0q0S 7?O0K d H-,MC@( (000 000 (000 (0"  20(00"  20(00"  20 0l"  l20(00S (0000("  ,20(00"  20(00L 0S 010!  10ӏ00!  10ɏ00`!  |10࿏00h!  \10൏0 0@!  810૏01!  10ࡏ0$0 0S 000   00(081    00}(00S S S(؄(w0K  ,8LX ` h Tp  XH-K00 0 (0040 00 40  0KH-pM` d h `000 00h 0N 0S 08T0KX K h H0 0S 0*@ `0 T0K 0`dh 8 0S 000h 0$ 0S 0T0KX K h H0 0S 00KH-`MP T X \0 040 4000 0@0 @080 P0P0 40K ᢅ( (0S0 0 00 0 0 000 m  0R000 P00!80K ͇( (0Sl8  010  00 0 P0 P00X 忄( (0S^P04 P00DKX傃( (0SP401 0 0 40  4 \0S 00040 40  P0 P00X 卄( (0S,P04 P00DKX_( (0S4000 0S 0SP0 0!@0K ( (0S<0KPTX g( (0SP0P0 00K ( (0S00  0$0 00K00 00 0[S-00<  00 00  00 !00P  r !00$ r  0 \0S 00000 00  @ 01 <00   0<0 P08 010 P00X( (0SP04 P00DKXƂ( (0S0H0 \0S 0 40[HKPX( (0S 0 40[HKPXu( (0SsH0S 00KP000 P00X( (0S`P00 P00DKX哂( (0SR 0[00K00! r !000   0R\:0S00  P000 P00X厃( (0S-P00 P00DKX`( (0S0 0 80,0 @080 ,0@0 $00$0 0S$80 0 80S P0 80@0S P0 @000S P0 00 40S P0 40(0KH-8M0 4 8 <0 8 002<S 0020s0S 00@000 <00S S < <002<S 0020s0S 00@0000 0 801 002<S 0020s0S 00@080 c 000s0?00R*0 0s00 08    r  r  br8 8 ! 8 8002<S 0020s0S 00@000000 002K 000s0&0K<00$0 0<80 0 (0K A|0 00 0 00 6| 000S 0 0004  0S 0< <002<S 0020s0S 00@00000 000S St 801 002<S 0020s0S 00@080 c000s0?00R*0 000 08    r  r  br8 8 ! 8 8002<S 0020s0S 00@000000 002K000s0&0K<00$0 0<0 0 (0K {0 00 0 00 {u801 002<S 0020s0S 00@0800cS0 0d00 08 ! Br8 8 ! 8 8002<S 0020s0S 00@000000 02K000s0&0K<00$0 0<00 0 (0K 9{0 00  2{0004  0S 000 <00x{0 00 <00n{00KH- M  $0 00 02<S 020s0S 00@00 0 01 02<S 020s0S 00@0 00c S0 02$000 $~00 00 0 ! Br  ! 02<S 020s0S 00@0000  0K z0KH-(M  00 0K ፁ 0S 0@0 00 π 0S+0 00K 0S 0! r !0 00 宀 0S 0 00K 0 0a0KH- M@@ 000S 000tB-| p00 d000S 0 | 400 (000S 00K$H- D@@@000S ,000B00 0$H-Mt00@Kd  R 00 00 0 K( 000K .KT$H- Md00@\  R x00 00 0 K 00xK$H-M|00@K    \  R R00 00 0 K 00|KD$H-MT00 KH  R10( 00 0K60K$H-Mp KK \000S0 <00 00000 KJ0K<$H-(00$  00 y0H- CM@B@  $ ($ K{00 S$0;K 0C 0C ;K 0C 0C8{0 ;K 0C 0C 10 y0K V 0S 0[$40s0S $40$4 $40$4 042 3/ 0S*02 (3/ 0S 0$2 3/ 0S0AP$| ;K 0C 0C ($  04/ 0S 媀00D 0K 0k 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  k 00 0 5`000S000 0 00   00   00  00  j 00 0 0 00  j00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  j 00 0 5`000S 000 0 00   00   00   00  j 00 0 0 00  j 00 0 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K  Xj 00 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K  2j 00 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K  j 00 0 `000S00 0 00  00  00 0  i 00 0 0Sd0SHl008 K`q 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`q0KH-ML00  8 0 05t 0S 00KԖpH-DMTG@8 < @ D0 800$0 00 00 00 <0 00K8 h 0S0000CSE5"D0S D0S D0S D0S00 :000S3 00 3D0S D0S00 *00 'D0S D0S D0S00 00 D0S D0S D0S D0S 00 850p ^0S` D0S000S $0L0 $0L D0S D0S00000 80K 6?OR00T0S 0 0 0S 0S.D0S&000S" $0 00L0100S $0 00L010  008 0 6?OR00T0S 0 0 0S0 0 $0L0 $0L 0S 00 $00S $008p0S 7?O00L $00Rt$0 00L010(0 (00S((00S$D0S D0S000S000S@0 @008s$00S $008g0S 7?O(000 0S 026S D0S00D0S000 $00S6 $008g0S. 7?O(00S' $00S $008g0S 7?Oz00L0$k 0S h$00S $008g0S 7?Oa0SJ 0SG 00X0S 000 40K8|r 6?OR 0S> 6?OR 40S 02@ 0"0 0 D0S00 0n, ,0S 0S,0 0  cp, ,0S 0S,0 0  0S0 @0 00S 008o 0KlH-LM( , 0 40 (000 00S 00(o0S 7?O00L0s 00L 00R0 00L0100 00 0Sy 00S 00S 00(f0S 7?O0000 0S^ 000S 0T 00T0R000S 08 0000 o0S 00S 00(f0S 7?O Eh026S<  o800S 00(f0S 7?Ob00X0S 4 00X0$K( 0e 0S 0J0H00S 00(f0S 7?O9000S00L0( Pj0,,0S ,0 0 0 , m,0  (0 ,0 00000  @0 P0 L0 T0 X0  @ 4 (,  l0KH-M  00S _ 0S 00KH-MA@  100   p00p0 0   00p0 0   00p0$000 <:86420.,*(&$"  p0.  %c0f p0. Y0S0S0 l0tK 0 \0S 0I 0 t0W0A p0- Y0S0S0 l0xK 0[0S 0$ 0 x0*\0 p0l- |Y0S0S0 l0|K 0[0S 00 |0_0p0, WY0S0S{0 l0K 0[0S 00 0a0p0H<02Y0S,0S0 l0<K 0u[0S 00 h0@K 0d[0S 0< @0 M^0p0t;0X0S\0Sl0H;0X0S a0l0;0X0S a0rl0:0X0S a0cl0:0X0S a0Tl0h:0X0S  a0El00:0X0S a06p090X0S,0S0 l0<K 0Z0S 00 h0@K 0Z0S 0< @0 .V0p0$90`X0S0SM0 l0<K 0Z0S 0<0W0p080=X0S0S,0 l0<K 0Z0S 0<0U0p080X0S,0S 0 l0<K 0]Z0S 00 h0@K 0LZ0S 0< @0 `0p0@70W0S0S0 h0@K 0'Z0S 0gl060W0S@0 V0Wl060W0S@0 V0Gl0X60W0S@0 pV07l060W0S@0 `V0'l050W0S@0 PV0l050wW0S@0 @V0l0h50gW0S@0 0V0l0,50WW0S@0 V0l040GW0S?@0  V0p0407W0SV0S.l040+W0S]0l0T40W0S]0l0 40W0S]0l030W0S]0l030V0S]0l030V0Sx]0wp0P30V0S=0S0 l0<K 0Y0S 0Z0 h0@K 0 Y0S 0I0 d0DK 0:_ 0S 07<@ D0^00p0820V0S p020V0S0Sl0$X0p010uV0S0St0 l0DK 0^ 0S 0D0SaD 00 0p0@10OV0S0SRl0]0p000=V0S{0SBl0001V0Sa Z0T(8Ldx(@Xp  <Pd| 0<L\ht(8L\l(<Pdt$4Dl000U0S 9Z0Wl010U0S@ *Z0Hl0H10U0S Z09l010U0S Z0*l010U0S Y0l010{U0S Y0 l0(20lU0S Y0l0`20]U0S Y0l020NU0S Y0l020?U0S Y0l0300U0S Y0l0@30!U0S Y0l0x30U0S  Y0l030U0S vY0l030T0S ]0l0 40T0S ]0vl0X40T0S x]0gl040T0S i]0Xp040T0SM0Sl040T0S N]0=l0,50T0S ?]0.l0d50T0S 0]0l050T0S !]0l050pT0S~ ]0p0& aT0S0S0 l0K 0V0S 00 06S0p0& J0h$0:S 00 0S10 -J0W(0S h10^NOFJ9M$09S 00 0S 10 J06$0!0S 01* 0!00S00 0S   M 0S 000 $ K0K|>N(0S 0!0 0! 0!00  0!0K @ T - M  0L 0 0Ћ/H-M  000 0L0S0L0 F 0S 050 P 0T 0P00CR0P0 0P 0P0!0L0 qL 0S 00L0T0 ! 0TCI 0L 0T010 0K- M  0X 0 0Ћ/H-M20     R "0 FI0    rR ,   -Rw  wR     -Ri  xR @    -R[  rR     -RM  wR     -R?  xR     -R1  rR     -R#  wR     -R  xR     -R  R R  0 L00X0S 0X0 fJ0X0  tH 0S 0  00 0K\ !D!- M  0 0 Ћ/-M  000 00 0 0  Ћ/- M  0 0 Ћ/-M  000 00 0 0  Ћ/- M  0 0 Ћ/- M  0  Ћ/- M  0 $ 0Ћ/- M  0 < 0Ћ/- M  0 @ 0Ћ/H-Mp00       R  4 R0 0>L00 8 0K\|!- M  0 0 0Ћ/H-Md00       R 4 0 G00  0K!- M  0  Ћ/- M  0 0 Ћ/- M  0  Ћ/- M  0 , 0Ћ/- M  0  0Ћ/- M  0\ 0 0Ћ/H-Md00       R 4 0 kG00 \ 0K!- M  0H 0 0Ћ/H-M  000 0H0S 0H0H0H0 G0K-M   0@S! @SS S0CS#S S S  S  S S  S S  S  S  S 0| 00S  0 00Ћ/-M   0@S! @SS S0CS+S S S # S  S S  S S  S  S  S0S 0| 0 0| 0| 00 0| 00Ћ/H-M000   0 J0K!H-M`00    R D  8  , 0  0J0K"$","H-M00     R  R@R R  R  R    |   p   d   X   L   < 0 0J0K`"h"p"|""""H-(Mh $ ( ,0 000 0 0 00 00 00 00 00cJ_0K"0H- @ME@@ D H L0 @00,0 00 0$0 $0 0 00 00 0S 0 0S 0 H0S H(C0S @H E0?@0S @00 0 D0S;:'-@0S ,0L0S00 -,0L 0100$0 $0S 000 00 0S 00 00 ,0L00$0 @0S ,0D0$0 @0S ,0H0$0 00 0S ]A0PP$0S $TA000PH0S HJA000000 00040 <0K@4 %F8 80S 8000 <0(0 0S- 00S) B0S <0(0 00  A0 0S / (0 (00(0 ( 0 >( 000(0 (00C0" H0S000 $0S- $00S) $oB0S <0(0 00 $@0 0S / (0 (00(0 ($0 >( 000(0 (00C0! H0S000 H0S- H00S) H>B0S <0(0 00 H@0 0S / (0 (00(0 (H0 >( 000(0 (00C0 ! ]H0S000 (0 D0S<0@ ?0S 0S <0@F0$0 0S <0@L 08 80S <0@yF80 0S<0@pF< 0 0 K0x#H-0(0S020 80(>08:@08  20 >8/@08  x20 >00 $0K E8@08 00 $g6f6F!C!? c0100 cr000s 0 $ g6f6FC?0c$0 00C0 00XS 00 0 00 40>0- <  08 D 0S0O0S 0@10 80=0C00 00 00S00s0   S 010 CO<>D?0c0 0S00 00C0 0 CO<>D?0c0cs0a0s 0 0 CO<>D?0c0 0S000 K ##$#0#-Ml00    R   R  R   0Ћ/@D#H-$MC@  $0 000 20 ?F 0S 06?O020  0@ 0S 0 09S$ ?0SL20G090$20 :@ 0S 0z 0;S10G0o 0<S B0S10G0` 0@0S10G0U 0;S`10xG0J 00S3 :010 0~@ 0S 06:000 9o@ 0S 0' 00S00JG0 0;S00?G000;S X003G0 $0F0Kh#x###$$L$x$$$H-LMJ@@ D H L0 000 @000 00 080 @DH L0@ 0S 0@010 H09S 80K@ 0S80S H00S 90F7?O0 (H00H0 H 00S t> 0S< 0S@ \ 0S H00 0 H0;S 00 0 H0:S 00@ 0 H0:S 00 0 H09S 00,0 H00S 00+0 040 H0 0S 40040 @010S 40040 H0@0S 40040 H00S 40040 H0<S 40040 H0<S 40 040 H0;S 40@040 40K 0P= 0Sy400s0S H0 0H0 400S H0@0H0 400S H00H0 400S H0 0S 0(A 0S (00s0S 7: 19 0S 0S00 0KH%H-BMMxA@  $ ($ ,4 400 $40 0S(40S(40S :0S ;K 0C 0C0 0K   ;>> 0S 000S  00 {? 0S 0 0($ ,4S ,4> 0A 0S 0 4H0S(; 0S 00KX%H- M20 $   $ R "0 yB 0S 0S00 0S9 00S5 0000S/ 0010S)  00S 00H0S 00H0 2S  : 0S 00S 0000S 0010S :0W 0S 00S 0000S 0010S 90@ 080S00 0K  v? 0S 0. 00S 00H0S 00H0 2S 000 0S :; 0S 0S00 8 0S 0S00 0K`%H-M  000 00 00S B 0S 0S00 < 0S 0S00  o 0S 0S00 00S 70  0S 0S00 0D0S 0D04@0 D 0H0S 0H0(@0 H 0L0S 0L0 0  00@ 00 0 00S0L0 @0 L 0 T 0X0S 0X0?00S 00?0  X:0KH-4MPF@( , 0 (000 00 00S %8 0S 0S00 00S IA 0S 0S00 00S$ 00;S00S 00: 0S 0S00 0  A 0S 0S00 (00*8 0S 0S00 008 0S 0S00 0L0S4 40A0P00 #0,0S 0, T40 000S<404400Q 0 A000 0S0S00 0 P 0P 0T 0H07 0S 0S00 0t07 0S 0S00 0|0S 0|0?0 | 00S! 00@0S 0000 B05 0S 0S00 ; 0S 0S00 00S ; 0S 0S00 00S 00H0S 8 0S 0S00 080S 0K {= 0S 0S00 8 0S 0S00 00S ? 0S 0S00 00S 00@0S ;6 6 0S 0S00 0<0S 0<0z>0 < 0 0S 0 0n>0 $ 0 0(0S 0(0_>0 , 0 ( (0, !0Kp%%%%%H-M@@ 0l0S0d00@ 00H   @w80l00 0S0K<%&H-Mh00       R8 0 T<00 0 0K&K-JMC@  $ (! ,1 ? "K 1040 0t0 00 080 00 h3000 00 00 10<041<0 0S 10S 10H0S 10@0 @00D0 D0H0(: 10 ! L @ L 1000H0 H0d0 H0d t0K 4, ,0S00 00 (1S t 0K (!47, ,0SN 400SI t K0K , ,0S40 0R;00K40 F?K=0 K );0K -?L L0S L0 00K00 KF?K=0 K ;0K ?L L0S L0 K0K ?0,0 p0K , ,0S | x0 ?  0K 0 <0(0 400S(1S 0R 0R0#03s0 0R 0R*00s0S 0K K(0St Kp0K 09, ,0S 0 >40$0SE 0R 00cf`p<b 08 0"K 00cT`p0<  c00K<G 0  0ᒃ 0"K0PK? Dž0S0Pu0S ? "K0,0 80S4 100S0Kp  0K0p  0K0p  0K0p  p00 K 30S t Kp0K 08, ,0S , 6?OR 0R 0R 0K , 0,0 ,0S)t Kp0K 0Y8, ,0S0(! K $ 80<, ,0StpK0K00K0"K 00  07, ,0S80S(1S 40|00S 0 D=<0000 t Kp0K 08, O MbP?4'X'40$0S$ K K0K <0 0"KN 0:> ᬃ 00"0P0 40$04P 3/0K K 1 p K0K <, ,0S , Y7?ORf0,0 t Kp0K 07, ,0S 0R 0R* 0R 0R:00s0S, 6?OR  0R 0R030#s0 0R 0R:00s0S 0K *, 0,0 ,0S.1000 0K K(1S400S 0K t Kp0K 0h7, m40$0S$ K K0K <0I 0"Kᣃ 00  0c0C0P0 40$04P 3/0K K 1 p K0K <, ,0S , Y7?OR0,0 0R 0R030#s0 0R 0R :0 @@d'&&l'''''0s0S t Kp0K 06, ,0S , 6?OR0K , ,0S(1S0 H0 400S- t0S t0{3, ,0S0t0 0000  B00, ,0Ss H00 0 00  ,17, ,0Sb 10S 10H0S 10H0 20S  0:, ,0S (1SY,0SV0,0 H0 0S g6, ,0S H P:, ,0S/ 10 ! L L (1S 00S00S H00  H00 (!M2, ,0St0S t02, ,0S0t0 00 ( ,1j7, ,0St0K 0, ,0St Kp0K 006, ,0S , 6?OR0,0 30;0K 7, ,0S%t Kp0K 06, ,0Sp 0K  ;, ,0S 0 @; 0K 0 G9t Kp0K 05, ,0StpK0K0(10"K 00  05, ,0S H0 0S 3, ,0S b6, ,0S(1S%400S!t0S t0X2, ,0Sq0t0 0K  0y;, ,0SgH00 K  06, ,0S]40|00SY 0KF5 KF?K790 &  .;0S 001H H  P d& l& ;2 00 8;&$"  t0S t01T T0S ,0ST0,0 0S 0 A940 10 ! L @ L H0d0 H0d ,0KH-M $ ( ,0 0Sf (0 00R(0 000cm@P,i 0? 0!K(0 00R$*(0 000c0CR@P 00,  c(000G`p,C 0 0 0!K(0 000c.@P(0 000c%`p,! 0 0l 0!Ke(0 $00R$0 (000c@P, 0؀ 0!KK(0 $00R$$0 (000c0C@P(00,  c$000`p, 0ᲀ 0' 0!K $0 (000c@P$0 (000c`p, 0᐀ 0 0!K!KKH-HM@ D H L0 (0K K60<0 0S 0S 080K@5 0Sk }( <0K@ 9 0S 00S< 00K 0 H00R 0 H00R0#03 , H00R , H00R*000 00K8 K0 H00R 0 H00R0#03 , H00R , H00R*000 0S L00 K!< 80K 80S40S6?O 0 <0@70<0 8 K(0KD 03 0S <0S <0@6L00SL00S0S 0S 6?OR(0KDL 0|3 0KH-PMH L P T0 <0K 5 K<0KL 0d3 fH000S@0K<  @0K0<  @0K0<  @0K0<  <0@ K {.@0 S8< 0KH ;8 0S/0 0R 0 0R*000 0R 0 0R*000 0  T0 0 P0 0H_6 0S K<0KL 02 0S 0KH-0 02 0S70 0/ 0S00 00 0S)0 02 0S"0 0+ 0S0 0 - 0S0 0O, 0S 0K 0H- M\L@  0 00$0 00 j1( 0,0 <0K, / 0S 0<0  <0  <0  <0 ( 0S <0< (  ( 00@0S <00+  2 p;0 K \;0c.<0 0K  0G3 0Sc00@0S<;00S70S <00     R02 0S" 0S <00|* +I<0< (  ( <00    @02 0S'<00 d0K`K, 0S <00) {+d0*`000 0S*0S0 80K\K 00 0S\0S 0S00 <004) R+800 40 0 00,0 00<S 00 <00( 9+0 0 X0K 20L0 0D0 < X0K  0S<0<   <0<  X  <00,0 ,00S,0 0S ,00S,0 0S ,0 ,0 0 070 057?O0 00 ,0 (0R 7057?O0 ,00S $010S, y,0 80@Rl<< @0K' 0S!@0S <0@  600S@0 0RU0S 0 ,0 00 0 00S 60>500 C,0 0 <0 @0 0 0< 0 0<0< (  ( X0K j1 30 000 0 00010 $0d0 00 $0 $00#1PH,0 00 04P,0 00 090 0L0 0D0 < X0K ! 0S<0(00S$ <0 L0 0V<0<   <0<  X  < L0X0C4<00,0 ,0 ,0  hKl Kp0K 3h0 ,0 l0 ,0 p0 ,0 ,0(  ,00.,00.0S 000,  0,00 , <0 0001 @0K 2 0S 30 )<000@0S @0@0 <000c, 0000 @0 000 @00@0  00R:,0 < ,0< ,08 ,08 ,04 ,0 @ ,0 H ,0H ,0D ,0 $ << @0K 0S <00"  840S<00 :<0@  @0L  @0D  D0s L080 D040 0 80K\K 0. 0S <00! r)< 0 0\ 00S 00+0  <00S <0 0S<0X K <0<   < <0(00 j<00S <00I1<0E10S0S 000 0S|003 00  000 /0 K0 d(t(x(d(((,)X))))*-M 000 00 0 0(00S0 80@00Ћ/H-M  00  0f*0S 0B00 0 000 0$0S 0$000S 7?O-0(0S 00S00S00 0  0$0S 0$09(0S 7?O ( 0S 0S00 0K- M  0S 00S 000 R   Ћ/H-M 000 00 0 0(00s0S 0$0 0 0S 0, 0 ( " 0$0S 0$0P00S 7?O 0(0 0( 0$0S 0$0'0S 7?O00,0 0KH-MLA@ 000 0S0F000 00<S1 0$0S 0$000S 7?O/0(0S0020(0 C0( 0$0S 0$0'0S 7?O00,0 00@0S 0$0(00K8*H-0M0 4 000 0 000 00 000S 0000* 0S 0S00 00  40S 0 0,K 0, K 000S 000@0S 000 0 0000 *00 0 0 0 4  0S 0S00 00S 000/0 /0KH-PMP P000 0100 01 0!P 0(0SOP000 000 0  000@0S 00000 00000 0 0 *00S 00S H0K, .00@0 0 0 H0KP S(0S H0KP ( 00 0 000 0, 0RP 'P01 0!0!0 0!0KH-\MC@X 30P K 30b)P0K 0 K X 0G.$ $0S00F1 0S00 0 000K300  000K 0 000 ,0K( K X X'$ $0S X$20 0& 0 [ 00X.$0S00 (00 i, 0100T20 2(0ST, 0100 20 $(0SH , 010010 (0S< , 010010 (0S0 , 0100l10o/0S00 !, 0100 0 K X 0-0S00X %00XM.00C0 0S0s , 0100 0 K X 0-0S00X %00X"., (0X 4.K t(x(d*h*p*x**H-DM(B@8 < @ <0(0 <0( 80 0K8< = 0S 0q<08   <0 0 <0 0 <0 <0(00s0S 0@  t10 <004K@(<0 40K 8 0$- 0S08< x 0S<00 <0(008<0(00s0S 0 0<K00#<00S <0(008< <0 <0  <0(00s0S 08y<0(0 <0( 0KD*H-M   0 00 00@0S 00 00@0S 00S 00X( s 0S E00S 00K- 0KH-M   0 :R0 ?R0 0=?0  00 0=?0  000@0S 00X , 0S 0/0 0  - 0S 0 0 0 0000 0 0 0 0 00R 0 00000c 0 0KH-M   0 00 0 00R 0 0 0 0 00@0S 00,0 )0KH-(MŸ $ ( ,0 ,0 $000 00 00 0 0 $000@0S 000$00 00000 00 <00S 0S,0 0 ,(00S (0 00R!,(0 00R(0(00S 0S 0 00R00 0 0R000 000 000 0, 0R0, 0R00 0S ,0  0/(0(00S0( 0S 00.0  * 0  (0 0 (00S00(00 0(0(0 (0( ,0  0K*-M  00 0 Ћ/-$M  $0 00@0S 0000 001<S' $0S 0 0   000  0$ 0< 0 0R:0 0   000  00 00 0< 0 0R:0Ћ/H-,MB@( , ,0 (000 0<0 K 3/0$0 0|00S 0(P"  -00$0K0((20 0* 0S]$0   ( 0* 0SP(000  ( 07' 0SB$0 0KK(J$ 0S6 0S0S0|00S 0 $0(-,0 (,? 0S,00S((000  ( 0& 0S ,0 00S 00(b%0 $0S $0(+0K***H-MF@  00(0 00 0$0 (0<0@ K( 3/60 @0K#W%(0|00S @0t&  4-00 (0 t0KDK 0' 0S 0D0S D0S 00 t0K50 f*0S (0|00Sv 50 -pt K0K Q*0S50"-0S(0|00S t0K$0 $00$0 $00 S D0 C_0K 0 0 0 0#K#K000   #K3&0S000  #K%& 0S 0(0|00S D40 $0,00 (0|00S  40 $0,000 [0Sd (0|00S @0#  ~,(0 P0KLK# 0S 0P0 0"zpjL0 0 0#K(00  0;( 0S 0< 51E<51E!!010!0 cR0000 (00H K l20 0& 0S 000C0 0S(00  0' 0S 0v00 (0 t0KDK 0& 0S 0dD0S t0K10 N)0SN0 0 0#K#K000   #KN%0S3(0|00S @04     0+(004   0' 0S (0 0KHK 0x& 0S 04 (0 0S000 0 0KЈ,| ++4+P+\+++++H-$M@@ $ 000 00 $0S00   0\' 0S 00 K p00 0-& 00 U# 0S 0S00 0 0Ku4+H-$M@@ 000 0<0 K 3/0|00S 0    4+ 000   0$ 0S0 400 ,00 0'0Ks ,0,*H-M00  0 K 0 000  0 K 0$ 000  0 K 0 000  0 K 04 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0h 000  0 K 0\ 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0D 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 08 000  0 K 0). 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0O/ 000  0 K 0 000  0 K 0T 000  0 K 0$ 000  0 K 0D 000  0 K 04 000  0 K 0/ 000  0 K 0 000  0 K 0). 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0H 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0( 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0@ 000  0 K 04 000  0 K 0 000  0 K 08 000  0 K 0 000  0 K 0T 000  0 K 0 000  0 K 0& 000  0 K 0 000  0 K 0\ 000  0 K 0L 000  0 K 0 000  0 K 0 000  0 K 0A/ 000  0 K 0 000  0 K 0L 000  0 K 0` 000  0 K 0, 000  0 K 0D 000  0 K 00 000  0 K 0 000  0 K 0H 000  0 K 0P 000  0 K 04 000  0 K 0 000  0 K 0]/ 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0 000  0 K 0, 000  0 K 00 000  0 K 0 000  0 K 0, 000  0 K 00 000  0 K 0 000  0 K 04 000  0 K 0< 000  0 K 0( 000  0 K 04 000  0 K 00 000  0 K 0 000  0 K 0 000  0 K 0p 000  0 K 0 000  0 K 0 000  0 K 0X 000  0 K 0 000  0 K 0, 000  0 K 0/ 000  0 K 0T 000  0 K 0 000  0 K 0. 000  0 K 0@ 000  0 K 0x 000  0 K 0 000 00 K b&0KH- M20 $   R !0 Y"0n !0$ 0% 0S 0a 0S 00S 0000S 0010S 0J 080S00 0K  " 0S 08 00S 00H0S 00H0 2S 000 0S ]000 0S $ 0S   0S 0S00 0S 0  0K`L,H-4MpC@8 < 0K K00K#08<#  %8< 0S 0<00S 8<v 0S 08[ 0S 08Q  0S 0<00S0800S# l2008`"  %8<# 0S 0$2008"  %8< 0S 0s800S 1008!  z%8<C 0S 0]800S t1008h!  d%8<# 0S 0G800S 800H0S 1008   I%8<%% 0S 0,800S 0008   3%8<O$ 0S 0800S X0008L   %8< 0S 00K|^`,dt,H-00@-  "$00@-  =0$00@-  D000S=0=0@-  =0#0 0SX=0P=0@H-  @=0#000 0S 0=0@-  =0#00S<0<0@,  <0#00S<0<0@x,  <0#00SD<0<<0@4,  D<0#0 0S<0;0@+  <0#0$0S;0;0@+  ;0#0(0Sx;0p;0@h+  ;0u#0,0S4;0,;0@$+  D;0d#000S:0:0@*  ;0S#040S:0:0@*  :0B#080Sh:0`:0@X*  :01#0<0S$:0:0@*  D:0 #0@0S9090@)  :0#0D00 0S 090@)  90"0H0 0 0S 0X90@P)  |90"0L0S0L0S8080@(  ,90"*0L00 000 K@( 000 00S00S , 00R 00@D(  "00@[ 0,0 ,000 0(0 0X0$0 $0S $0 80@(  <80"0\0@((  80"0`0S7070@'  70}"0h0ST70L70@D'  70l"0l0@'  |70b"0p0S6060@&  <70Q"0t0S6060@&  60@"0x0S`60X60@P&  60/"0|0 &  @ 6000@`&  l60"00@8&  H60"00@&  $60"00@%  60!00SH50@50@8%  50!00@l%  50!00@T%  x50!00@,%  T50!00@%  050!00@$  50!00@$  40!00@$  40!00@d$  40!080 80<0 040 00< K@l$ <0K@X40 P40<0S 8 <0R <0@D#  t!<0@080 80<0 040 00@#  30`!00@X#  30V!00@0#  30L!00@#  `30B!00@"  <308!00@"  30.!00@"  20$!00@h"  20!00@@"  20!00@"  20!00@!  d20 00@!  @20 00@!  20 00@x!  10 00@P!  10 00S0000@   10 00@   p10 01 X!  @ D100KWdt,,--------. ...$.0.8.D.L.T.\.d.l.x......,....///,/ 3D#9 K$   0S0K 00 ,0 0K 00 ,00S  0R 0 P   0 200 00 00 K,2.666t,H-,M`B@ $ ( ,0 00 00 00 ,00,0 06C0 ?0@R(00(0 ,0;C,0 , 3R(0S ,0S 0S0K 10 TC100 (0S 0K x10 (0Eh100 ,0S 0K,  @10 05(100  3R0#%0K 00 0#0;#;0000 0S 0K 00 00K 00 $00S  0R 0 `   0 00 00 00 K06 6$6-,646<6 0t,H-$MB@  $0 200!  10 00 0S 010!  1000!  |10000 0S 0@108!  81000$!  1000   00v00   00l0 0   00b0$0x   00X$T0(0 d    P00EK.dt,D6-.\6.l3h6,t666666- M00  R h 0` 0X 0 P 0 H 0@ 08 00 0Ћ/+677 777(707H- M  0K  0S 0<0 0 0 4  00 [000S0  00  00  00  0  P 00 0 000S00 0  00 00  00 00  00 00  00 0  " 00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 00 000S00  000  000  000  00  00 0 0  00 0 0 000S0,0  0,00  0,00  0,00  0,0  p 00 0 000S000  0000  0000  0000  000  G 00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0"d0S000 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d  0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 040 L0K`  0S 0L0080 0S 8 400c0 s80 0 `000ST0K0 0 00T K 00T K 00T K T0K  f 00 0 `000SX0K0 0 00X K 00X K 00X K X0K  B 00 0 `000S<00 0 00<  00<  00<  <0   `000S 00<   00<   00<   00<   0 <00 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S000 0 00   00   00  00  00 0 0 00  00 0 0 `000S00 0 00  00  00 0  q 00 0 `000S 00 0 00  00  00  0  M 00 0 0Sd0SHl008 K`K 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`0KH- M  0K  0S 0J0 0 0 L  00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  f 000S0 0  0 00  0 00  0 00  0 00 = 00 0 00 000S00  000  000  000  00   00 0 0  00 0 0 0,0 000S000  0000  0000  0000  000  00 0 0 , 000 0 0 000S0H0  0H00  0H00  0H00  0H0  00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0gd0S0b00 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d _ 0S 0Bd0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 00  0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 040 L0K`  0S 0L0080 0S 8 400c0 80 0 `000ST0K0 0 00T K 00T K 00T K T0K   00 0 `000SX0K0 0 00X K 00X K 00X K X0K   00 0 `000S<00 0 00<  00<  00<  <0  t`000S 00<   00<   00<   00<   0 <00 K 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  " 00 0 5`000S000 0 00   00   00  00   00 0 0 00  00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K   00 0 5`000S000 0 00   00   00  00   00 0 0 00  00 0 0 `000S 00 0 00  00  00  0  g 00 0 0Sd0SHl008 K`e 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`50KH- M  0K  0S 00 0 0 \  00 000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 W 00 0 00 8 000S00  000  000  000  00  ( 00 0 0  00 0 0 000S0,0  0,00  0,00  0,00  0,0   00 0 000S000  0000  0000  0000  000   00 0 000S0K  0K0  0K0  0K0  0K  0 4 00 0 000S080  0800  0800  0800  080  ~ 00 0 0<0 _ 000S0@0  0@00  0@00  0@00  0@0  O 00 0 0 < 0@0 0 0 000S0X0  0X00  0X00  0X00  0X0   00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0X0 00 00 l00S d0S0d0S000 00 d0S0\0 D0K<0 0@0 @0D0 ;d0@0S X0`d   0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0\0 0S 00( ( 0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` {  0S 0t40 L0K` n  0S 0gL0080 0S 8 400c0 A 80 0 `000SX0K0 0 00X K 00X K 00X K X0K  4 00 0 `000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 `000S<00 0 00<  00<  00<  <0  `000S 00<   00<   00<   00<   0 <00  00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K   00 0 5`000S000 0 00   00   00  00  p 00 0 0 00  e00 0 0 `000S00 0 00  00  00 0  ? 00 0 `000S 00 0 00  00  00  0   00 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K   00 0 `000S00 0 00  00  00 0   00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K   00 0 5`000S000 0 00   00   00  00  ~ 00 0 0 00  s00 0 0 `000S00 0 00  00  00 0  M 00 0 0Sd0SHl008 K`K  0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80` 0KH- M  0K  0S 00 0 0 h  00 000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  f000S0 0  0 00  0 00  0 00  0 00 = 00 0 00 000S00  000  000  000  00   00 0 0  00 0 0 0,0 000S000  0000  0000  0000  000  00 0 0 , 000 0 0 0H0 000S0L0  0L00  0L00  0L00  0L0  00 0 0 H 0L0 0 0 000S0d0  0d00  0d00  0d00  0d0  o 00 0   0 0KH-(M   0 0000 000 000  00KH-(M   0 0000 000 000  00KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0d0S000 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d  0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 00  0S 000 0S 0000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 0B40 L0K`  0S 05L0080 0S 8 400c0 V80 0 `000ST0K0 0 00T K 00T K 00T K T0K  I 00 0 `000SX0K0 0 00X K 00X K 00X K X0K  % 00 0 `000S<00 0 00<  00<  00<  <0  `000S 00<   00<   00<   00<   0 <00 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S000 0 00   00   00  00  00 0 0 00  z00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  O 00 0 5`000S000 0 00   00   00  00  % 00 0 0 00  00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S 000 0 00   00   00   00  00 0 0 00  00 0 0 `000S00 0 00  00  00 0  00 0 0Sd0SHl008 K` 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`b0KH- M  0KA 9 0S 00 0 0 l  00 000S0  00  00  00  0   00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 00 e000S00  000  000  000  00  U 00 0 0  00 0 0 0,0 .000S000  0000  0000  0000  000   00 0 0 , 000 0 0 0H0 000S0L0  0L00  0L00  0L00  0L0  00 0 0 H 0L0 0 0 000S0d0  0d00  0d00  0d00  0d0  00 0 000S0h0  0h00  0h00  0h00  0h0  00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0d0S000 00 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d F 0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 0S 00  0S 000 0S 0000 040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 0f40 L0K`  0S 0YL0080 0S 8 400c0 80 0 `000ST0K0 0 00T K 00T K 00T K T0K  00 0 `000SX0K0 0 00X K 00X K 00X K X0K  w 00 0 `000S<00 0 00<  00<  00<  <0  S`000S 00<   00<   00<   00<   0 <00 * 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K   00 0 5`000S000 0 00   00   00  00  00 0 0 00  00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  00 0 5`000S000 0 00   00   00  00  w 00 0 0 00  l00 0 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  A 00 0 5`000S 000 0 00   00   00   00   00 0 0 00  00 0 0 `000S00 0 00  00  00 0  00 0 `000S00 0 00  00  00 0  00 0 0Sd0SHl008 K` 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`0KH-MPA@  <10 0 0S 0A 10 0 0S 0400 0 0S 0'00 0 0S 0|00 0 0S 0 L00 0 0S 00K<,LH-PM8 < @ D0 040 0(0 0040K08D 0s 0S 0f0S=0800S8 800S 800H0S 800H0 20S(800S 800L0@0S<0S $0K D0$0 D00 0 000 K$K8<x 0S@0S(0K@0 40 @  8 0 (0K@ R(0S (0840S 4080KH-hMP T X \0 0L0 00L0K0P\ 0 0SlT0S T000S X0Sd L0  PX  0SWP00SF P00S P00H0S P00H0 20S6P00S P00L0@0S,T0S) $0K "X0$0 X0S00 0 @0K \0@0 \?00<0 H0K@ K $ K   PT 0 0S L0 PT X0 L0S L0P0KH-M` d h l0 00 0 0 0X0 00X0K0`lh 0\ 0S 0`00SI `00S `00H0S `00H0 20S9`00S `00L0@0S/d0S, ,0K 0,0 0(0 H0K h0H0 h00D0 P0KH K l      , K   `d 0 0S*0SX0   ` 0 0S00 0 ` 0 0S0T K ` 0 0S0S 0` 0S 0S0 0 X0S X0`f 0KH-Mp t x |0 0h0 h0l0 00l0K0px 0 0S~00h0K0p| 0 0Ssp00Sb p00S p00H0S p00H0 20SRp00S p00L0@0SHt0SE \0K x0\0 x00X0 @0K |0@0 |00<0 $0K 0$0 0 0 0S 00d K\K@K$K pt 00d K\K@K$K pty 0Sl0h   p|   l0S l0ph0S h0p0KH-M  $ (" ,2 0 0 02 00 $2 0K   0S 0?K0 0, 00K  0 0Sc,2S ,2S>2  K  00S+"?K   0S 0 q (2 2S 2 0S 0 0KH-(M  $0 00 00 00 0 0K . 0S 080H 00K 0@ 0S$0S $0S 0,0 0   0 0S 00S 0 0KH-@M( , 0 40 00 0 0 ,0 0K(  0S 0=00 40S( 40S% 40S 40S 0 00 0,0 0` 4P 8@ < @ Xpp`P @( 0S 00  0S 0(a0KH-M   0 0000  00KH-M   0 0000  00KH-M0 4 8" <2 0 0 0 0 ">K0 00 0(2 (2$2 00 42 0K0  0S 00H00 0d 0,0K0 0^ 0S0d 00K0 0M 0S<2S <2S| <2S <2S$2(20 00 0K00 00S ">K    0 <0S0 00Sy0H 040 \0Sp 000 0 <2S <2S8$2 K 0 00S+ ">K    0 K0,"0 0S0S>000S 0 00 09S 0<0 0 0 00<0 000 00 0 0dS,<0d 220S226S,00S 02 ?K2 02 ?K T K ,8 " 0S2S00 #22;S   0S0(0 2 00 2   2  `2,  0S22;S `2 D K , 0 0S'09S 0;S 00 =2h2 22;S "0  4`D0:S 2S00/K0\0K0, 22;S  ?K0 ?K_00 0S1 22;S  0$,  (20 0$,   (2:00 00 0S0S 0>0S 0  0S 0S00 0S 0 0KH-dMB@X \ ` X000 0,0 000 0(0 X02;S `0,0 \000 00,0K0` 0: 0SO0000K0\ 0- 0SD00S 0P0 P0KL0 0H0 X0X L0K(K  0S,X02;S,0 000 0S 00 ,0!  X08 00,X`  (0S (0K000 0S 0S00 X02;S00S 00iX02;S,0S ,0]0Kd<H-pMX \ ` d0 X00 0 X02+X0"X0$0 X00SX0* \0S 00SI X080  $ 0S? X0800 000 0\ X0 " 00S) 00S 00H0S 00H0 20S 00S 00L0@0S`0S X0P0S X0P0$ X080 X0$ X080. 0SdX\d  0S^ 00SR 00S 00H0S 00H0 20SB 00S 00L0@0S8`0S5 \0S2 L0K |\0L0 \00H0 00K pX08000 0,0 X0P0S X0P0 000 X0 T0KLK0K ` 0 0S X02 X0"0KH-0M $ ( ,0 $0S1 00S 000S 00000S 00010S 00n0I 0080S00  0 0K 0S 04$000 00 0$0 KK $0F 0S 0 0 0, ( ~ 0$  00 0S 0S00 0KH-@M  $0 00 00 0 029S 000 000K0  0: 0S>000000  09 0S1 $040   0S($0+ 0000000 0$00<00000  0 0S08 $040 0S 0 0KH-0M $ ( ,0 ($ 0& 0S 0|$0S1 00S 000S 00000S 00010S 00|0\ 0080S00  0 0K  0S 0G$000 00 0$0 KK $0T 0S 0/0 0S 00 0+ 04 080 0$ 0S 000 0S 0S00 0S,0+ 0KH-M  " 2 20 0 02 22 00 0t0 229S 000 00?K0  0/ 0SK 00S 02 ?K2 02 +>K K    0SE2  0S2 t K  0 0S"t?K  K0 "0 0S2  0 0S 2S 0S 0K t0S t0  0S 0S00 2S 2 N2S 2 G0KH-M  0 00 0 000 0|0 0K   0S 0F0 "+"0$0 00S 00 0K0 00 0K | K   C 0S 0  0SI0 0 0S 00 0    0 0S 0| K   0 0S0h0 0 J|0S |0K 0h0 02:S00 0S 00SN 0SK 40K t08040 000 P0K j0P0 00L0 l0K ^0l0 00h0 0KP K l K 4 K  0} 0Sr08040 0l0 o00h0 0Kl K P K 4 K  0c 0SZ02:S 080    0 0SH  080    0x 0S7080     0i 0S*0| K   0 0S0 h  00  X 0S |0S |0K "0S 0 k 0S 0S00 0K-$M  0S 00 00   000 0 0 000K000 0[S 0R <3F0[ =3 9?O K 0 0K000"s >?OK0 000 0?Sd0KBd K0K@ fd0KDH!aN/Kd0Kd0K/d KI?K@ Sd KN?K Md0KLKH-M   0 0S00 00 0S0 0000S  0 0 0S 0 00 " 00" 0 0 K ~ 0N0S 0    ! 00     ! KH-tMt@@p t x h0Kh0Kpt h0K<00 h0Kpt h0KxbKr|<H-HMŸ @ D H L0 0SH0S @100q0 0 00 H0S@100b0 0 H000 D0S (0KL  L (0KL0 0S x00 D0S D0 D00 "00"0 0KL 0S 000 $ <0K D0S <0K< KD   ! <0K0< K D   ! <0KL 0S 000 D0S 0S 0D0 0Kpq<<H-$M`A@ X10  0S 0E 10042! 3/ 0S10002  3/ 0S#000$2  3/ 0Sx000h000   -  0D K<D K80K 0>0S <0< d  d 000D K0`0D K04 <00 04 0d <00 0d <0 0H 0 T 0 @ 04 0D 0|00S 00 0408<0S <00K`(=H-dME@P T X \0 P00(0 P0<0,0 0<0 <00 X0 ,0D1S? T0S ,0d1s ,0Y? ,0d100 ,0d1s ,0Y? ,0h,0d1s ,0Y?,0d100,Y,d0`00000 00S 00 X0 00 \0  0H0K P 0f 0S H0(0H0>4 40SH30 0 40 H0 0 D0K@ K (  X 0S (20 0H0(0@00 00 080 D 010020 40SwD 01000$0 B0 $000000S $00$0 $00S$00SYD 01000080 T0S 0S <0S 8 0RJ0S 8 0R<:00<0K000P8 0 0S D 0100((! 22<0S%#T0S T0S 0S <0S8 0R800 <00 00C0 0ShX0  D @0( )H0( \0  0K<]\=`=d=l=H-\ME@H L P T0 H00$0 $00(0 080 0,0 00 0@0 T0S T0 0S00D K80KHLT 0S D0$ 0B 00 00 00 $00S 000 00 (003/0 00 00  0 @0K$) 0S@000 @0 00,0 8@ 00<K$ 0S 0 <0R 000S,00S,00S  0S00 D0$ # `$000S$00S000N$00S6 00 00cS $`300000   b,   $0(  0S $30(0(0(00 ,00`$D>H-(M( (000 0 00 000 0 0 (00@0S ( 0S 0S0 0 ( 0S 0S0 0 00S 00(70S 7?O00s 00 00000 0D00S ( 0 0S 0 0 00s 00 000 0S00S 00(0S 7?OZ(00@0S 0X0( 0S 0S0 0 000@0S 0,10 0,100$0SD 000@0S 0$00 0$003 00s 00 0       b  0 00        0 0Y?0c 0h!  0 00  0d1s 0Y? 0d100 0 0S1 00s 00 0       b  0 00        0 0[?0c 0p!  0 00  S0l1s 0[? 0l100 0 0S1$0 0s $0 0$ 0$ $$$   b  $ $000$$   $   $0 $0W?0c 0`!$ $000 $0\1s 0W? 0\100$0 $0S01S 000@0S 010 0100 !0( 0S 0S0 0 ( u 0S 0S0 0 00S 00( 0S 0S0 0 0  00S 00(((0 0KH-M  000 0<0 0 00<00S 00<000S 7?O0 .00<00S 00<000S 7?O0K- M 0000Ћ/-M 00 0 0 0000 00S 00H0S 00H0 2S 060 0Ћ/H-HM@ D H L0 <0K@q 0S 080K < 80KD 0 <000 <0n 0S 0S0 0 0S 0@000 0<00 @00<00S @00<00@0S 7?O 0S0D 000 H 04 0H0 04 0D1S 00 0@0 0S00 H0 000R 04!H000c0 00 H000R 041 0H   b B 00 040 00 04 H000c0 0 0#: 0 0| 046 0| 0X0S 0X0@w0S 7?Og0` D00R 0` D00R030#s00d D00R 0d D00R:00s0S 0 `00 0X0S 0X0@0S 7?O10 8 0 < 04 0D L0S L0 0 000@c 0S@00<00S @00<00@0S 7?O 0KH-0M $ ( 000 0000SD 00<00S 00<00 0S 7?O0<0 0 0d1s 0Y? 0d1000 0S 0 $0R00( 0 00<00S 00<00 M0S 7?OX0V(0 0K $ 08 0S 0 0A0  0S3 00<00S 00<00 0S 7?O&0<0 0 0000 00<00S 00<00 0S 7?O  $0R(0 0 q0KH-AMM 70//OK//OK//OK   <  //OK  0 Q //OK  0 Q 3 #r //OK  4 Q //OK  4 Q: r R //OK&00|0D1S 0d1s 0Y? 0d1000 {00s 00 00 0 0 ??OK00Re00s 00 0     b  0 00      0 0Y?0c 0h! 0 00 0l1s 0l!0[?00c 0 0[? 0l1 00s 000c0 0 00 0[? c0p!0   0[? c0l!0[? 0 c0 00 0S000S 0 ??OK0  ??O K0000 :K0C40C(K  00S ??OK ??OK^??O K0 0:K0C40C 0 0S*5( ??OK00??OK ??OK  ??OK ??OK'0S 0000 ??OK ??OK0o??OK ??OK0 ??O0K4KK 0 0SD00*40 ??OK000c 0 :K0C00C*0 ??OK0??OK 0  0S 0 S:#$0 0//O:K0C00C,KK $0 0S  $00c 0 0S0 ??OK0  0KAt>H-M   0<0 0 0d1s 0Y? 0d1000 0 00R0 00 001!0 0 000s 00 000 0S6?OKH-HMH L H0<00 0d1s 0Y? 0d100D0 D0S& D0 0@0R *0@ D000cDS00s0 00!0@D000c0DS00s0S D0L  D0 @  0L0S@0K4 0@ @0KH 400@04 0010!0 0@ 0l1s 0[? 0l100D0 D0SH0 D0K 0S 0rD0 4D00s D D000D  D D D   b D0 D0 00D D   D   D0 D00[?0c 0p!D0 D0 00 D0L  D0 @  D0  D0 Y/D b h! 0h1SD0 0Y? c0d!0Y/0h10 h!bD  Y/ b D00 0Y? c0h!0KH-,MD@0 4 0000 00<00 404040 t ,0KL  $0K0 00<00S 00<000S 7?O$0K 00<00S 00<000S 7?O0S 00 0 $ ,0R  (0R306?O$ 0L0R $ 0L0R030#s0 0P0R 0P0R:00s0S 0L0$ K0T0$ K0 00S 0@ 0T0R*0T 0@00c00!0T0@00c04 So0d1s 0Y? 0d1000 0S 0@ 00R*0 0@00c00!00@00c04 Sj00s 00 0     b  0 00      0 0Y?0c 0h! 0 00 0l1s 0l!0[?00c 0 0[? 0l1 00s 000c0 0 00 0[? c0p!0   0[? c0l!0[? 0 c0 00 08 0K5>H-M   0 0<00  0 001R:00!00c0 0 0 00  0R *  00  00c KH-M   0 0<00  0 001R:00!00c0 0 0 00  0R *0  0  00c K-M  000 0<0 0 0  Ћ/H-`MP T P000 0<00 0<0 0 0 0L0 0D1S L T0 080K p<0KP 0Sg<D K80K 0; 0S 6?ORX0 0 bD00 <D K80K 0% 0SI0000L0K0 03 0S<D 0R: D0  H K  0 0S,L H0R- D00C0 0000L0K0 0 0SL H0R00C0  0R* <0S <0l 0S 0S0 0 0ST0S L T0 0KH-4MB@( , 0 (000 00Sh20 000S* <200 0c 0S 000200 0o 0S 0q00100 0` 0S 0b0S 00S 0000S 0010S0K080S0$0 $0K X 0S 0900S 00H0S 00H0 2S 000 0S 000 0S,0  0S ? 0S 0S 00 $0S $0  0K(,>H-GMMK 0C0C"0S  h 50 0?E>K 0C0C$0 0$0 p40p4 p4SM8KI GFE-h$l$ P0K T0Kh 0ST\ KP0K 0 T0!0 00S 0S000 0S\00 h\0Kh 0S  6?OR00 \00C0 h30 @00 0!`0Kh  0S`0 00 ~d0K ( 0 0S d0hd0h z0S p40S \ 0RY d0hm0d0 Y0 C0R 0@00 0!`0Kh  0Sg$0S d `010h$ 0SZd0hDd04 40S 40 `010h F 0SBd0h*` 010d  0d0 ` 000 010 00C0 0S}0S# `0 10`0Kh 0Sl4S1 ` l4 - `0S `0 0  00h 00 0 00S`0hd0S d0h0Kp)?,?H-8M8 < 800<0 0 00 ,0K 800S"8<[ 0St<00S <00S8< 5 0Sf<00S<00S 6?O0 ]8< 0SU00K8 0S& M<0 0`0R :<0 0`0R<0 0d0R *4 <0 408_4 <0 408U0 ,0K< 0 0S , 40K8  0S 00 0S 0S00 0KH-M@@ 0K   0S  6?OR x00 0S 00 00  000 00S bK  0S 0A@00<0 080 400< K00K 4< K00K 0> 0S000 000SI@0@ 40 0 @0< 40 0S 0S00 0S@0< D0 0KAH-(MlŸ $ ( ,0 00 0 ,0S ,0#00@0S3S $00S$00S$0 $00 0p 10 0h 0S 00S 0000S 0010S 0L 080S00 0K   0S 0: 00S 00H0S 00H0 2S 000 0S 000 0S $( ,0 0S  0S 0S00 0S 0  0K8A\AH-(M $ ( ,0 000 $ 0K $( ,0X 0S $0 K 0K$00SF,0S ,0S ,0S ,0S:,0S S 0,0 0,0 (000 000S@ 0$ 400 0< (000S (00(0 $( ,0 0S $0 K 00KH-MtI@  0 000 000 00 0 0<0$0 00 0d00S 00l0 40K 00CS񏐞 l /40S00S 0 00000 00 t Kp0K   0Sp0St040 040 t0040 000 k40S00S. 00S'40S6?O0 $0D1S400C p K   00Sp0S p0S 6?O0 400C40 0000 6l0S0l0 00<00S 00<000S 7?O$00040 $04 $0H00c00  40K\60 w40040 000 00S 0080 00  080 00 4Kh Kx0K| 0SNx0S0,0 0(0 0d00S 4 00R 4 00R*.0 0 0R 0 0 0R:00s0S 0d0 0d 4Kl K,0KhKxKK 0Sx0S 0S c$0D1S/l0S0l0 00<00S 00<000S 7?O4 K,0KhKxK|K 0 0S|0Sd0S)00CS30O 00SF6?O0 0d0 0d l0S0l0 00<00S 00<000S 7?Ox 80d 80ch Kh0K0 m 0S" 0d00S 0S 0sv00 x0sr4 008S,20NO6 dl0S0l0 00<00S 00<0010S 7?Obx 80 d800c E 0S700S 00(00d8 bh K $0 0 000R$0T0S 0 0T0R 0S 00 00T0S 0 0T0R00d00S0 000K\A$BH-DMB@( , 0 40 (000 000 0<00 (00S (0L ,0R (009 (0  (0 L 0S 0v(00SF(00 K,U 0S 0S 0 00 (0d00S  0S 0X10L! ࢻ 00F 0(k 0S 0  002 0(0, L 00 0 (00 4 0    0 0S (0d00S000000 ,0X00KP\BpBBH-Ml00    R  d  R     0 00KBH-(M $ 000 00 0 00S 0 0KK$ 0S 0 0T 000R*0*0 0T 0<00 0T 001R*00! 0T 0KH-M`C@  0 80K @0K H0K l0K$ κ0 000 L00L0 00 00 00 0000 000 00S0 K 㮺000 0l K  㤺000 080 040 000  00KK] 0S 0xd0K K080 040 00|0B>S d `0D00|0B>S 0 0844\0 0R:0S L 00L0 l K80KHK 00|0B>S H0D      0y s y s&/OS S'/OS S 00 @0KH K00 0Rd:0S00 0@ K0K(BB00h>0`>0 X>0UO=0 0` L00R 0` L00R 0d L00R0L 80KP0Sh 0\0Sd 0\1s 0W? 0\10000 00S/H0 00K Ꮅ 0SH00 \00  0S H0 00x0Y000S? 000_0S7 7?OJ00 0s 0 00 000 0 0 0   b  00 00000 0   0   00 00 0W?0c 0`!00 0000 0H1 0H! 0L!80R 0L!80R0#03s0 0P!40R 0P!40R*00s0S 0S?8 K0008 K 0T1s 00 T U/0  b 0U? 0T1 00 0s 00 0 0c00 00 0 0U? c 0X!00 00 0U? c 0T!00 U/0  b 00<00S 00<00F0S 7?O000S 000ᤴ0S 7?O00<00S 00<00ᑴ0S 7?O| 0H1 C 0H!0000$0 000    0\1s 00 \ W/0  b 0W? 0\1 00 0s 00 0 0c00 00 0 0W? c 0`!00 00 0W? c 0\!00 W/0  b $0S 0\0 C 0\ 80KS/0& 0X0S 0X0+0S 7?O8  0`0R :8  0`0R4  0d0R* 0X0S 0X0ᠫ0S 7?O 0@0S9 8  080R 8  080R*.4  0<0R 4  0<0R:00s0S H0 0@0H q 0S 0X0S 0X0f0S 7?O 0 @ H00S H0 000R H 0S 0X0S 0X0B0S 7?O 0@0(0 0D0,0 @0K8  0\0 0\ P0S 00<00S 00<000S 7?OtH00 0S* 0X0S 0X00S 7?O\P0S 00<00S 00<00[0S 7?OFձ 0@ 0`0@ K(0S 0, d 0X0S 0X0Ϊ0S 7?O&P0S 00<00S 00<00%0S 7?O 0\0 C 0\ 00 0 00  0H1S 00 0T1s 0U? 0T10000 0` 000R 0` 000R030#s0 0d 000R 0d 000R:00s0SG 000S 000\0S 7?O00 0s 0 00 000 0 0 0   b  00 00000 0   0   00 00 0U?0c 0X!00 0000 000 R0SO000    000S 000 0S 7?Od00 0s 0 00 000 0 0 0   b  00 00000 0   0   00 00 0U?0c 0X!00 0000 0\0 0\ 00 00 0s 0 00 00بlF4GFFF000 00S/ 0 0R* 0  0 0R 00S 0  0KH-(M $ ( ,0 0<00 001 0 0D1S 0@0 ( ,00@ ,0 001)0 0@ 0r0@0S0$ 800@0S',  0R#:, 00 0  ( X 0S 0O0 ( 0(0 0 , 0c,0 00 0 90@0 0c0  ,0R010 0 0@00( 啩( 00(0 , 00c,0 0@ 0 0@ 0@ 0R 00   0S 0 0 @ 00 0 ,0S0KH-000S 000X0S 7?OH00H0 H00CS\00@0 0000X 0/X  0H0 \0 @0R0L0 000S 000X?0S 7?O|$00s $00 $000Sn000S 000Xᴞ0S 7?O^$00S $00X0S 7?OO00 00 $00s $00 $00000 0 0s0$0s00SH0S0 h0R*0S 0 00R00 00 0l0 00S H0S 0S 0 00R00 0$0s 0$0 000 0Sl0 0sS l0 0l 00SG X0000@0S l0 0l 00 X00,0 l0 0l000<00 X0000@0S l0 0l 00 X00,0 l0 0l000@0|0 $0$ 0R $0$ 0R030#s0$0( |0R030#s0S 00s0Cl00S; X0000@0S l00X00,0 l000<00 X0000@0S l00X00,0 l000@0|0 $0$ 0R $0$ 0R030#s0$0( |0R030#s0S 00s0S l00 ~P0S$0$0XᖧT T0S T0G0P0 M0 0s 0 0 000 0S0S0S 00 0080 \0D0S \0D$ `00cC"01000000Q80180 (0S$0(0 80<0 8 <0R)$ (0R% $00S $00XC0S 7?O(0p0 $0(0 p0$0 80<0 $00S $00Xᙥ0S 7?O40040 0(0 0000@0S 00000 000t0 0T0 000S 000s 0 00$t 0YT 000Cs 0 T0S \00 \0 \00 \0 T0Sit0T0Se P0S0$0s0 0sS 0 0 00SI X0000@0S 0 0 00 X00,0 0 0000<00 X0000@0S 0 0 00 X00,0 0 0000@0|0 $0$ 0R $0$ 0R0#03s0$0( |0R0#03s0S 00s0E00S? X0000@0S 00X00,0 000<00 X0000@0S 00X00,0 000@0|0 $0$ 0R $0$ 0R0#03s0sM$0( |0R0#03s0S 00s0S $0$0X,0P0 0$0s0 0sU 0 0 00SI X0000@0S 0 0 00 X00,0 0 0000<00 X0000@0S 0 0 00 X00,0 0 0000@0|0 $0$ 0R $0$ 0R0#03s0$0( |0R0#03s0S 00s0SFY00S= X0000@0S 00X00,0 000<00 X0000@0S 00X00,0 000@0|0 $0$ 0R $0$ 0R0#03s0$0( |0R0#03s0S 00s0S H0S 00 0S 00S0K0$ 0厢T T0S00S T0S H0S $*00 0S$ 000s 0 00$ 0 T T0S $00S $00XJ0S 7?OT000 0S 00$ 0T T0S T0000S 000Xᑣ0S 7?O0 0\   b\    \00S \00 c\0 \0 \000\  b\   b 0 \00 c\0 00 0 0( t0\00x0 0 0 0\   b\    \00S \00 c\0 \0 \000\  b \  b 0 0 \00 c\0 000 0 00 x0R:00 ^0S 0\ t0\0R00$ 0YT T0S T0I00 t0\ ,00,0,0 00$ 0CT T0S T03H0S0H0 $00S $00Xo0S 7?O000S 000Xˢ0S 7?O 00 ,0RyKH-M   00 弝KH-M 00s 00 00000 00 0 00s 000000 0`00 0   0R~ 0 0s 0 0 0    b   000      0 000c 0  000 0 0s 0$0s 00 M00 0 00 0 c0 0 0 0 0S 00 c0 0 0 00  b  b 0 0 00 c0 0  0$0s 0$0 000 0SKH-,MDE@ $ ( ,0 000 (080S $ ,00; 00S 00١0S 7?O, 0 00 0 (0R 000S0   0 00 0S 00S 00D0S 7?O0SM 00S(0L0S 0  B 0 00S 00ᑡ0S 7?O00S 0010     00 00S 000S 7?O0S 300  B 00S(000S 0(00<S(0L0S 0(0@0S8 (0@0s4 00S 0040S 7?O 000 0 (0@0R 000 0S 00S 00ᦘ0S 7?Of0S0a0Kᒠ 0S 0W0( \  ( 0* 0S 0㶟(080S0>00 0$ ,0 0S0, 00S 00ʠ0S 7?O00S0   0  B 00S 00@0S 7?O0KDXMH-@M $ ( ,0 00 0 000 0\00 (000s (0 $00S $00 0S 7?O00 00S 0 (00(( K  0S1 0R*,0S6?O0 '0|0s 0|000 (0(0 )0l0 0l 0p0 0p 0@0S ( 0000 $00S $00 $0S 7?O)(00@0s (0 0S(000s (0 $0,00s0S $0,0 $0, $00S $00 ᎗0S 7?O0KH-DMlD@( , 0 40 ,0S ,0000 00 00 400@0s 40 000S 000(`0S 7?O0S 080S(00S2 0x0s. (00S (00H0S (00H0 20S (00H0 28S40( 0x00 K 㐗 0S0S 0K( 0Sg0@0S 4000S 00 ,4 w 0SV,0 400\\4( $K( 0S ,^ 400(50t0 0t 40 00R*00S 00(@0S 7?Oe40 00R40 0 00S 00(ẖ0S 7?OL000S 000(0S 7?O:0S 4000s 40 0S 000 C00 4000s 40 40 400@0s 40 00,00s0S 00,0 00, 000S 000(n0S 7?O0K$P NH-TMB@H L P H000 00 0 H00$0 $0@0(0 (0s 000 . 00S 00᫞0S 7?O 000 0 (0R 000 0S 00S 000S 7?Oe0S0`$00S00  0000@0S $00 00 $000D0 $00@0 D0K0 P0S 0 0S& 0 0L0 L0(0 00 0=H H0S H0Q 00h0 00l0 000`0SC 0S@ 0 0S< 000 00S0 0,0 00:S ,040 0 00s 00s T  0H H0S H0 h0S0!0S ,0D0S ,0D0T H H0S H0 0S S" '\00S \00T+0S 7?O \0 0 \00S \00T᫒0S 7?O 00 0L0S \000s0S 0 \00R0 L  \\ \0`0 \0` 0 T00p0 p000t0 t00S_p000 000@0S \0\ 000cx0 0P0 P000P0 t0( P0R00$00"x 030b10 !P00L0 t0( L0RP00L 0L0 000@0S t04000 t04000 L 000200 00S 00Tሚ0S 7?OI 0H0 0 0KKT\ߘH H0S H08 00$0 000 080 00s 00 00000 .00000 0 00R0 d0R 0 0s`0So l0Sl 0Si 0$0s 0$0 000 0SZ 0S 00S 0 T0000@0S 00T00,000R? 00S; T0000@0S 00T00,0 000<00 T0000@0S 00T00,0 000@00 0 0R 0 0R0#03s0 0 0R0#03s0S`0S h0S 0S 00S 0 T0000@0S 00T00,000R 00D0 00 0S 000S00 0 ?R 堑 00Tt.TH 000s 0 040 0@0 @0S%00S! 000Cs 0 00S 00T0S 7?O2 00 00 080 8040 T $s0,00S0 ,  , 00S 00TK0S 7?O 0   00S 00Tː0S 7?O 00S 00T)0S 7?O 00S 00T᭐0S 7?O 00S 00T 0S 7?O 0@0 00@0S T001 0Sp 0S 00<S 000Cs 0 00S00|0 040 00S 00Tj0S 7?O 000S 000TƘ0S 7?O 0S 0\ `00 |0S- 0 $00 0 c$00 0 $00S $00 c$0 $0 $000$  b$  b 0 0 $00 c$0 000S 000T 0S 7?O: 00 00 0 0s$ 0 0 0 00R000Cs 0 040 00S 00T0S 7?O 00 00 Zh0S 0 0s 6?OH0 \0d0 \0d 0 0 000 0S$00 $0 $0 00R*$00  $0 00 $0 0S0S000S000 0Sd=(@xNXNNNN0S000Cs 0 00Sl000S 0  B 000s 0 `0SO 00 0S30 0s/0$0s+00S' T0000@0S 00T00,0 000<0sT0000@0S 00T00,0 000@0s 000s 0 00S 00T$0S 7?OR0P 0X 0͏0EX\5 00T TH `0S 0S1000S, 0D0 D0<0 \00S \00TW0S 7?O0 \0 0R0 \0 \00S \00Tю0S 7?OD0S0S 0$0s 0$0 000 0S~ 0$0 00 0$0s00S0 0sS 0 0 00SI T0000@0S 0 0 00 T00,0 0 0000<00 T0000@0S 0 0 00 T00,0 0 0000@00 0$ 0R 0$ 0R0#03s00( 0R0#03s0S 00s0C00S= T0000@0S 00T00,0 000<00 T0000@0S 00T00,0 000@00 0$ 0R 0$ 0R0#03s00( 0R0#03s0S 00s0S 0$0TH H0S0 0sS 0 0 00SG T0000@0S 0 0 00 T00,0 0 0000<00 T0000@0S 0 0 00 T00,0 0 0000@00 0$ 0R 0$ 0R030#s00( 0R030#s0S 00s0C00S; T0000@0S 00T00,0 000<00 T0000@0S 00T00,0 000@00 0$ 0R 0$ 0R030#s00( 0R030#s0S 00s0S+ 00S'00 0S 000s 0 0X 0H H0S{  0X 0H H0S00 D0S0S 0S00S 00T%0S 7?OS080 0S0L\00S \00T|0S 7?O=0S S?0<0 \00S \0 \00R :e \00Tp0H0 4\0 0 0 .\00S 0 \00R I \00Tח0H0 <0S0 \0 0R00<0 0 \0 0R6?O0H0 \00S \00Tᮌ0S 7?OH0SQ0000 0000 00S000 000 0K`H H0S500$0 0 K X\ 0H H0S&<0S \00S \00Tה0S 7?O0 Sl0 \0 00Re \0 0 0 0000 0000 00S000 000 0KH H0S 0R> \00S \00T*0S 7?OX000S 000Tᆔ0S 7?OG 0\ #$0h0 C$0h 000S 000T0S 7?O+00 <0S 0 \0 0R0 \0 \00S \00Tދ0S 7?O H0S0SS 00S 00T60S 7?O080 !<0S 000S 0D0 D0S0S00S 00T᧋0S 7?O000S 000T0S 7?O 0\ ᠊$0h0 C$0h 000S 000Tz0S 7?O00 0 S 000Cs 0 080 8040 00 I00S 00TƓ0S 7?O00 00 , 㛒0 040 0  0 0 0d  0 00 0 c0 0 0 0 0S0   b 0 0 00  b  b 0     b 0 $ 0$ 0 <0S 0   000s 0 <0S' \0|0s0( \0\0 ;0( \0|0 20S \0@0S 000s 0 \0l0 \0l 000s 0 \0h0 \0h \00S \00T(0S 7?O\00 \0 \00S \00T᧊0S 7?O0S, 00<S 0X 0?H H0S?00 00 00 D0S 00S 00Tw0S 7?O080 U000S 00 rH H0S000s0S  㾉H H0S 000s 0 D0Sq 0Sn 0 0 0   r 000s 0 0   0   0   0  0S 0X\ ,0ߑH H0S<0S 0( \0\0 [0   r 0(0( \0\0 `0 0s 0 0 000 0S 0  b 0 0 c0$ 0 0  b$ 0 0 c0 00s 00 0000 S800s 0     b 00 00 0 0s 0 0 0c00 0     b 0 0    b 0    b K0  b 00000c 0s 00000c 000000c00000c 00c0 00 00000c    b  0 0s 0 0 0c0 00 0s 0 0 0    b   000      0   b  000 000Cs 0 00S$0@ 0 00 0R" \00S \00T_0S 7?O \00 \0 \00S \00Tވ0S 7?O 00 `0S <0S 0S X\ ,0匐H H0Sh0Sl0S<0S 000S 0   000s 0 0S 00S0  0 0s0$0s00s 00 0 00s 000000 0`000 S\ 0 0s 0 0 0    b   000      0   b  000 0 00 0 c0 0 0 0 0S0   b 0 0 00  b  b 0     b 00S 00T0S 7?O=0S T000 0!01R[010 0"0K lH H0S000@0S 0 00 0 00 !A 01 01 !000@0S 00 000c0 000@0S 0 000 0 000 0s00s 0!0  0$ 0R 0000@0S 0 000 0 000 0(0 (00S (00(0 011 (0R010s 0!000@0S 0 000c( 00 X000cC!;.:K (0 0 ( 0 40S0S) 80S00S 00Tᙏ0S 7?OZ080 0S 000Cs 0 40S  0R 000Cs 0 80S 00S 00T0S 7?O00S, 000S 000T[0S 7?O 0\ $0h0 C$0h 000S 000T҆0S 7?OH0KH-(M10 $ (  !0( 0㵐 0S 0a 0S 00S 0000S 0010S ?0J 080S00 0K  ȍ 0S 08 00S 00H0S 00H0 2S 000 0S ㌉000 0S $_ 0S 尋 0S 0S00 0S 0  0K4 OH-MA@  0K 9 0S 0g0  0 8 0  0  0t! X 0h! \ 0\! ` 0P! d 0D! h 08! l 0,! p 0 ! t 0! x 0! | 0  0  0  0  0  0  0  0  0  0  0  0x   0 0K8 8T@8lD- M  0 0 0Ћ/H-M`00     R   4 0 \00  0K0OH-Mh00     R  < 0y00 0  Ӆ0K4LOH-M00     R   T 0 0 0 0  㱅00 0 0KhO-M  000 0 0S0T0 0 0L0S 00 0 0P0S 00 0 0Ћ/H- M410        R R + 0S 0S 0T0 0T -0T0 0T ' 0 L # 0S 0S 0T0 0T 0T0 0T  0 P @ 0 0͎ 0S 00KhO- M  04 0 0Ћ/H-M`00     R   4 0 h00 4 0KO- M  08 0 0Ћ/H-M`00     R   4 0 ;00 8 0K,OH-M  000 0S0< 0 0@ 0 @000 00S 00᳌0S 7?O/0@0\000 0 0@0\000 \  0 00S 000S 7?O0KH-M  000 0S0 < 0 @ :000 00S 00[0S 7?O)0\0e0 0 0@0\ 00 C0\0T0 0 00S 00Ń0S 7?O0KH-M`00   D R  4000D0  0KOH-M10     R    0 Q00000 0K z 0S 0"0 0 ي 0S 0 000 00 Ã0    0D 0KOH-M00   H  R   0  0  0  0  0   H $000KTOH-M00   BR 0 H 0 H 0 H 0 H 0 H   L 0 0 00S 00 H D 0KX,PH-M  000 00 0 00S 00,0S 7?O 0 0 00S 00ᬂ0S 7?O0KH-M 00 00Ὃ0K- M00  R  R\ 00000@0S 00000 000Ћ/\dPH-4MB@( , 0 40 (000 200 0V 0S 00S 0 C00S h20G0(0 0R<20;0000S ,0S20-0v000S 00S100g0S 00S 0000S 0010S姃0P080S0$0 $0K 0 0S 0>00S 00H0S 00H0 2S 000 0S 000 0S40000(, 00j 0S  0S 0S 00 $0S $0  0KlPPPP$Q0H- `MO@X \ ` d0 X000S 0X00,0 ,0000 ,0040 000080 0D0 0L0 L0H0 0(0 (0$0 0P0 0<0 00 00000@0S 80000000 800000 \0Si`0SW X0T00s0S `ك0`  00O#0200c0 X0 0 00O#0200c0  0002 00 X000s0S^ 00S 00,ᐉ0S 7?ODd00\0K0,X `0>( 00S 00, 0S 7?O+(0S\0S0 0$0 -\00S \00,_0S 7?O\080S\0   0$0 \00S \00,ـ0S 7?O\080S 0X0T00S0 0 d00s0S 00 0 d00S 00 0 d00S X00 X0 0 0 0 ,0010S 00 0 \0S& ,00000S ,00000,0S 7?O00000@0S \000000 \000`0 00P0K0,` 0L( (0S P0X  ,<  0( \0S ,00000S ,00000,N0S 7?Oo(0S2X00 X000,  P( (0S%PX0 H0KLK,唁( (0S P0,() L0<0S d0@0S LPL0<00cL0 P0,H)  0(0 \0SX000SP X0 0, も( (0SX00 X0 \0Sv00S 00,I0S 7?Od00\0K0,X `00S00(0 (0SD0S? \0S<D0\0 0D0 00s \0   \  b 00 00 \0 0s \0 0 0c0$0 \0 0 00 c0 \0 \0 00 c0 \0  \  b$ >\0S; X00s \0|0s X0 \0|0R<0S \0\ <0R X080s! \0x0s X08 \0x0R ,60` Y00S 00,L0S 7?Om0(0 =00S 00,:0S 7?O[D0S D00S D00,ᕇ0S 7?OID00ᓅ( (0S\0SX0T00s0S d00S0(0 `0S X0T00SX000S P X0 0, チ( (0Sd00D0K00X` <0#( (0S<c0H 0 L0<[0 00 0S 00C0 DD0D   00D0 < `0SD0\0 00S 00,"0S 7?O\0 \0  \ b   $ 0 0S\0 00 c0 0 0 00  b\   b \0 0 00 c0 00S 00,v~0S 7?Od00S,\000S d0<S \0\  , \0\   d0<S00s \00<S00s00"s0S ,820E0(0 8d00S \0T  T X00 X0 \ X0 \000s0S 400S 400 6@0 `0S X0T00s0S \0\   pX000S\0\   eX040S \0\   [d00S401@0S \0\   L,00000S ,00000,J0S 7?O800S 800 6@0 ,00000S ,00000,}0S 7?O`QdQQQ@0#*H0R :@0#*H0R @046L S\0\   X0 L \000s0S H0*L0 X0P PX0 X0P0XL,0S X0 L \0\   X00 X0 000S 000,؅0S 7?OX00S. 00 00 'X0 00RX000S000SX000,a~X00, 00  0 X0 0 00 0SX0 00 X0 000X  X0 00 000S> 000,}0S6 7?O; $0S! \00S \00,f0S 7?O\0  B \00S \00,|0S 7?OP0S P0,[(0 K0H-M   0 00 0 00s 00 00000 080S00<S0T00s0S4 0L0S 0000@0S 00 000 0000S000S- 0000@0S 00 000 000G0 0000@0S 00 00000 ㎄0S{09S 00S 000S 7?O0 8 00Sc 00A|0S] 7?Os00S 00ោ0S 7?Od080S 00SE 00|0S? 7?OQ00 0 00S 00 |0S 7?O=040S 04 0@ 00s 0 0| 080s$ 08 0x  0 0s 0 0 000 0S0  0K0H- (M $ ( ,0 000 00 00  K  0E 0S0 0  0$ 4 @ 0, \ 0$ 8 x 0$  | 0$ H D $0<0S$0@0S @$00@00 0 0 0Ћ/-M 00 Ћ/H-MH    0 000 00 0S 00S10,|0600S 0000 0 0S 0H 0 0S 0L 0 0S 0$0 0 0S 0 0 0S 0 0 0S 00 0 0KP,SH-MA@  $0 000 $0S00 %0S 0S00C0 1 0  0#? 00 01 0 00 0S 0S(10{0A0 7R00t{020S ???AR 0#! 00o> 0 ߿0 ?R 0106 0 00 0S 00 u0 0  0  0  0KDStSH- M00       R   R 0,+{0"00CS00S 00 0 0000 0S 0 0 0 0 00 0 00KSH- M00       R 0,z000CS00S 00 0 0000 0 00S   0  0 00KرSH- M20 $     R   R!0,z0m00Sd 00 0 0000 0S 00S 0000S 0010Sq0K080S00 0K v 0S 0900000S 00000w0S 7?O$0 $0 00000S 00000?o0S 7?O 0S 0   0 $0 0KSH- M20 $     R   R!0,z0k00Sc 00 0 0000 0S 00S 0000S 0010Sp0I080S00 0K v 0S 0700000S 000007w0S 7?O"0$  00000S 00000n0S 7?O 0S 0   0$  0K贮SH-(M@20 $ (     R   R!0,y0u00Sh 00 0 0000 0S 00S 0000S 0010Sp0S080S00 0K u 0S 0A00000S 00000v0S 7?O,0 $0 0 (0 00000S 00000 n0S 7?O0S 0   0 $0 0 (0 0K脬TH-(M020 $ (     R   R!0,x0q00Sf 00 0 0000 0S 00S 0000S 0010Smo0O080S00 0K t 0S 0=00000S 00000v0S 7?O(0$  0(  00000S 00000m0S 7?O 0S 0   0$  0(  0K(TH- M20 $     R   R!0,ix0m00Sd 00 0 0000 0S 00S 0000S 0010Sn0K080S00 0K dt 0S 0900000S 00000u0S 7?O$0 $0 00000S 00000l0S 7?O 0S 0   0 $0 0Kܧ,TH- M20 $     R   R!0,w0k00Sc 00 0 0000 0S 00S 0000S 0010SMn0I080S00 0K s 0S 0700000S 00000t0S 7?O"0$  00000S 00000nl0S 7?O 0S 0   0$  0K褥,TH-HM8 < @ D0 00 0 0 0,0 ,0,0 0$0 00 00 00 000 0 0 00 800S  8000 000(0 0000@0S (000000 (0000 0 @0S @n0$0 0 $00,K0K s 0S 010 $00@ dl0SB Dxn0D v00O!#"020 c0002 0 0 @0S< @$ v 00O#0200c0 0000@0S (000000 (00000  0002 00 < mv00O!#"020 c0002 0 0 0S   0R*00S 008t0S 7?O 00S 008s0S 7?O0S   0R00S 008s0S 7?O00 @0SE 0SB 00s 00 00000 )080S0L0S 0000@0S 00000 000@t0S 0 0s 0 0 000 0S0S 0 0  00s 00 00000 .080S00<S0000@0S 0000 000< s0S 0 0s 0 0 000 0S0S0S 0 0 @0S)00S 0084s0S 7?O0L0S 00 C0 0 8 00S 008j0S 7?O0000@0S 0000 00000 , 0 0Sg 0Rc 0 0s 0 0 0 $   b $  0$00 $     0$  000c 0  0$00 0 < 0 00 0 c0 0 0$ 0 0S 00 c0 0 0 00  b  b 0 0 00 c0 0S 0L0S@0S 8D 1j 0S0 0 0S0 0 8D 0j 00S 0 00 i0S$ 00S 008i0S 7?O0S   0R 00S 008i0S 7?O 0KH-4MB@( , 0 40 (000 (000 00S 00%r0S 7?O0 00 00S 00i0S 7?Ot0 0R 400s0S 0i10t0b00$0 $0K K (, 0'j 0S 0P$0 S # 3r 0$0 R00S 00q0S 7?O700<S0L0S 0 00R:(0 0\00 i 0S 00 C0 0 0 0R0 0 00S 002i0S 7?O0KTHTH-0M $ ( 000 00 0 000 (0 0(0 0( 000S 0#0$ , $0S20$0 0 $014K  p 0S 0$0!00 0 (0 0KH-M 000 00 0 000 0(0 C0( 0(0S 0I00000S 00000(q0S 7?O4 0 0000@0S 040 000400 g00000S 00000h0S 7?O 0 , 0 4 0 0 0K-$M  000 00 0 000 000S0 0 0, 0 0000@0S 040 000 0400 00Ћ/H-0M $ ( 000 00 0 000 000S0$0!000Ri$0010C?0 00 0000@0S 040 000 0400( 0 0 0004K  o 0S 0R(0 0,01 Zh00000S 00000Rp0S 7?O3 0 (00 f00000S 00000g0S 7?O0$ , 0000@0S 040 000 0400( 00K- M  00  Ћ/-M 0 0s 0 0 000 0 0s000 0 0R*000 0$0s 0$0 000 0S0Ћ/H-M@@  $0 000 $00 0S |p0   Rr0 00S 00000@0S 0 00,00c 0q0K踏hTH-PMH L H00 0 00$0 H00$0(0 (00,0 $0000@0S ,0, $0000c00 00 H00 0  00 0 00S 0040 400080 800S]400D0 D000@0S ,0, D000c<0 00 0000 80( 0RL0$L0"< 030b10 !000 80( 0R00 00 D000@0S 8040D00 80400@0 @ 00020@0 @00S @00  o0S 7?Oi00 D0K@ K ,L dm 0S xm0V@00s @00 @00000 30 L0R0 00R 0 0s" 0S 00S 0 0000@0S 00 00,000R 00 0 0 000 0S@00S @00 6f0S 7?O0KH-MO@  0 000 000 00 0000@0S 00000 000 0 0\0$0 00 0<0 000s 0 00@0s 0 00S 00e0S 7?O%000S 000In0S 7?O00s 00 00000 0S6 0 0s 0 0 0    b   000      0 000c 0  000 00s  0 ;0 80K8 n0S08000 80 80  8 b    00S80 00 c0 0 0008   b   b 80 00 c0 000S 000He0S 7?O00S 00m0S 7?Oq0S 00  000cC!;.:K(0 000@0S 0400004000cC"01000000,0 ;0$ " K,d (0g0K K  0l 0Sc0  < K $ 0ol 0SC06@P0 0D0 D0@0 < P0KLK 0fj 0SCL0S@ < D0KLK 0Vj 0S3L0S0 < @0KLK 0Fj 0S#L0S  <0  0Wk 0S0S 0  < K $ 0l 0S< P0KLK 0j 0SL0S < D0KLK 0i 0SL0S < @0KLK 0i 0SL0S P 06@R 00 D0S!@00@0 @0D0 <0  0j 0S< @0KLK 0i 0SL0S 8< D0 $0j 0S< H0KLK 0i 0SL0S <0  0j 0S{< H0KLK 0i 0SnL0Sk < D0($$ LKn 0SWL0ST ( ;d0 0 0 00 0s 0 00@0s 0 0  0D , 00S 0000@0S 0000,0 000Wn 0S j0 0s 0 0 0000 00S 0 0 c0  00 c00$ 0 0 c0$  0 c0 0 0s00s 00 0000 S700s 0 0000c 0 00 00 0 0s 0 0 0c00 0 0 00 c0 0  00 c0 00 0 c0 K 0 c0 00000c 0s 00000c 0 00000c 00000c 00c0   0 00000c    b  0 0s 0 0 0c0 00 0s 0 0 0    b  000      0 000c 0 000 00S 00k0S 7?O 00 0 00S 00b0S 7?O00 0 {0S00 0Sp 00S 00sb0S 7?O000S 000j0S 7?O0 00 0 c00 0 00S  00 c0 ĊTT0 000  b  b 0 0 00 c0 000S 000 b0S 7?OX00S 00~j0S 7?OI0S 0j<0S <0d4 40S 0S400 0S 0 S `10 Qb00@0s 0 000Cs 0 0,00s0S 0,0 0, 00S 00a0S 7?O0K-M  00 0 0 0 000cЋ/H-MO@  0 00(0 0X0 00,0 0000@0S 00000 00000 0\0 00\040 0$0 00 0,0h0 0S ( a0 0 00 0s 0 00@0s 0 000cC!;.:K80 000@0S ,04000,04000cC"01000000<0 8>04 " K<d 80d0K K ( 0i$ $0St0(  X K (4 0h$ $0SgX p0KlK( 0f$ $0Sal0S^ X `0KlK( 0f$ $0SQl0SN X d0KlK( 0uf$ $0SAl0S> p 06@R 0$0 60S X h0(44 lK(k$ $0Sl0S 0 0 h d0Rd00 0!\0K( h$ $0S00 80 C0R 000 0!\0K( Mj$ $0S\ 010`  000 X `0( 40@g$ $0SX `0KlK( 0f$ $0Sl0S `0S\ 010h  000 \0 :0g\ 00C100 00C 000CR00C0 \0 R\ 010 00cC1@0 d0@ R0 0 X0(b$ 0X0 $0S0( A`$ $0Swd @00cd0 X d00( 40{`$ $0Sn\ @00c10 X0 ( 0f$ $0S[X \0lK( 0e$ $0SNl0SK X d0KlK( 0e$ $0S>l0S; 00 'X \0100( 40f$ $0S'X \0010lK( 0Ye$ $0Sl0S 000  @00c 0R0 0 0S8 X h0( 40Zf$ $0SX `0KlK( 0-e$ $0Sl0S X0 ( 0>f$ $0SX h0KlK( 0e$ $0Sl0S 0S ,0@ 0 0 0s 0 0 00D0 D0S D 0 c0  D0 cD0$ 0 0 c0$  0 c0 0 0s00s 00 0000 S700s 0 0000c 0 00 00 0 0s 0 0 0c00 0 0 00 c0 0  00 c0 00 0 c0 K 0 c0 00000c 0s 00000c 0 00000c 00000c 00c0  0 00000c    b  0 0s 0 0 0c0 00 0s 0 0 0    b  000      0 000c 0 000 0 0s 0 0 00H0 H0S0$0s 0$0 00H0 H0S 00s 00 0000 S700s 0 00H00c H0 00 00 H0 0s H0 0 0c00 H0 0 00 c0 H0 H 00 c0 00 H0 cH0 K H0 cH0 00000c 0s 00000c 0 00000c 00000c 00c0H   H0 00000c    bH  H0 0s H0 0 0c0 00 0s 0 0 0    b  000      xT܆T0 000c 0 000 0$0s 0$0 00L0 0 0s 0 0 00P0 P0S L0S L P00c0P $0L0S P0S P L00c0L  00 $ 0$ 0 000Cs 0 00S00S 00(Q]0S 7?O0S 00S (0000@0S 00(00,0 000( d$ $0S ($d000S 000(e0S 7?O0 ,00 0 c,00 0 ,00S ,00 c,0 ,0 ,000,  b,  b 0 0 ,00 c,0 000S 000(\0S 7?Oy00S 00(;e0S 7?Oj000S@00 @00C(0 @0(0 @0KH oa 0S 0)@0(0 000 $00T 0RL000,0 L0000@0S ,040L000 ,0400<0 <000 0S P0T 0 00 T 0002 <0K  a 0S 000@0S <0<0 000c$ 4000 A< 0002000 0S 0 0000 00S 0 00000 000  00 00  00  00 00 00 00 00 00 , 00 $ 00 ( 000  T0R:$0T 8 $0T  $0 $0 $0 $0 80K 8 a 0Sp80040 80 80$  8 b$    $00S80 $00 c$0 $0 $0008 $  b$   b 80 $00 c$0 40 $00 40 c$00 40 $00S4 $00 c$0 $0 $000$  b4$  b 40 0 $00 c$0 0 $0H 0 $0L 0H00.c0K[TH-M 00 0 0K  00/ 0000 0 0 0ዧ00 0 0R: 000 0KH- M  000 00/000 0 00 h00 0S 0  0S  < \ 0S 0k00  00  00$  0]00S 00&]0S 7?ON000 0 0R0  0$  000 0S0S%0K [ 0S 0*0  0  0$  0  0S 00   0 0   00S 00kT0S 7?O0KH-PMH L P T0 H000 0000@0S L0L 0000c 0 000$0 00 $0(0(0 00 0000  (0R:P0$P0" 030b10 !000  (0R:00 00 $080ᚣ0,0 0000@0S $0,0000 $0,0000 0 ,0, T0 T0040 40080 80S ,010 0 400R0S 0S 04000@0S 8040400 80400<0 $080,   c0002< 0<0 <00S <00H#\0S 7?O[,010 0 400R <00S <00HS0S 7?OCA$0(0@0 ( @0R5 00 0000  @0R:P0$P0" 030b10 !00 0 @0R:00 0 0 0R <00S <00HaS0S 7?O0<  0KH-xMh l p t0 h00(0 h000,0 00 0 0 00 0000  l0R:,080pᱢ000 h0 00,040 40080 4000@0S 8040400 80400<0 ,0800 p  c0002< 0<0 ,080tტ0@0 h0 @0,0D0 D00H0 D000@0S H040D00 H0400L0 ,080@ t  c0002L 0L0 L00S L00(:[0S 7?OL00s L00 L00000 Q0$0 $000$0 ,0( $0R00$00"0 030b10 !$000 ,0( 0R$00 00  t0R 00hDL 0AS 0S L00S L00(zR0S 7?O= 0;0 0s 0 0 000 0SL00S L00([R0S 7?O<00S <00(Z0S 7?O <00s <00 <00000 _00$00"0 030b10 !000  l0R:00 00  t0R00@0S00S <00S <00(R0S 7?O( -Y t0R00 0S 000s 0 0 0sS 0 0 00SG (0000@0S 0 0 00 (00,0 0 0000<0`0 (0000@0S 0 0 00 (00,0 0 0000@0\0 <0$ `0R <0$ `0R030#s0<0( \0R030#s0S 00s0C00S; (0000@0S 00(00,0 000<0`0 (0000@0S 00(00,0 000@0\0 <0$ `0R <0$ `0R030#s0<0( \0R030#s0S 00s0S 0X0 >h0000@0S 00h000 000P0 <00S <00(/Q0S 7?O00X0K0h4P 0X 0S 0<00S <00(~Y0S 7?OX00h4< 0P 0S <00S <00(P0S 7?O 0<00S <00(P0S 7?O0 0s 0 0 000 0S<00s <00 <00000 t00$00"0 030b10 !000  l0R:00 00 h0000@0S 00h000 000P0  t0R6000S 0 0s0$0sP0L0S' 0 0 00 00X0K0hDP 0 X 0SX0  X0  X0   X0   X0   X0  X0   P00S P00(X0S 7?OP00 P0 P00S P00(8P0S 7?OX00S (0000@0S X00(00,0 X000(Z 0SPX0(0( P0\0 rP0SX X0$$0 0X00 '0$0s 0$0 00T0 T0S X0TX  b$ X0 T0 cT0 X0 $ X0X  b X0 0 c0$ 0$0s 0$0 00 0 X00 0SIL00S L00((X0S 7?O~0 L00 0 cL0 0 0 L0 0S L00 cL0 L0 L0 00L  bL  b 0 0 L00 cL0 000S L00 L0 L00S L00(tO0S 7?O7000S 000s 0 <00 C<0 0 0s 0 0 000 0S 0S,0l ( <00S <00(=O0S 7?O 0KH- M 00 0 0000 0(00 00 0000 0( 0R0 000 0(00  00KH-0M( (000 (0000 (00 0 00 00 (0 0$0,00 0  0  0  0 (  P 0S 0@0$ 080(S 0S 00(0000@0S 0,0(000 0,00 0 0$0!   0$ 0 0 (r 0S 00 0 08 0R0KH- M 00 0 0000 0(00C0 00 0000 0(0 C0R0 000 0(00C  00KH- M00       $ R  0SY0$00  0S 0000 08 0R 0 0$0C0$0$0,00  BP0K+ UH- M 000 0000 0000@0S 0,0 000 0,000 00 0 0 0 0,00S 0 0,0 0100Rs 0 0,00S 0 0,0 O 0 0,0  0 0,0  0 0,0 !  0 0,0 ( 0 0,0 IO 0S 0W 0 0, 0 0,000@0S 0 0,0 00 0 0,0 0 0,0 0000 00 0 0$ 0Rk 0 0,00S 0 0,0 rO 0S 00 0 0 0R0KH-,MA@( , 0 (000 (0000 (00 0 0 0 ,0/000$0 0 $00 婜00 0S00 0 0R *00!  X0;00 00S 00rU0S 7?O*0$ 0R*(0(00 0S 0$ 0R00S 00L0S 7?O0K0'@UH-(M10 $ (     R   R 0,W0&00S 00 0 0000 00 0 00 00 0 0#/$0 0!(0  0 $0 0 (0 0KP%tUH-Mt00        R @ 0 :S00  0  0K0$UH-(MŸ $ ( ,0 00 0 00S 10,]W0p 10, 0CV 0S 0c 0S 00S 0000S 0010S M0L 080S00 0K  VS 0S 0: 00S 00H0S 00H0 2S 000 0S O000 0S $( ,0 0S 0S 7?O|0z00000S 000006>0S 7?Oe000K0 0g= 0S 0V0SR 0SO 00000S 00000yF0S 7?O; 0 00R 0 00R030#s0 0 0 0R 0 0 0R:00s0S 0 000000S 00000=0S 7?O0KH- M10    R   !0 zD0` 0S 00S 0000S 0010S >?0I 080S00 0K  D 0S 07 00S 00H0S 00H0 2S 000 0S @000 0S A 0S B 0S 0S00 0S 0  0K0`H-M 000 000S 0000<S00L0S 00H0S0 00   0]<0KH-M  0 0 00S 000   0?< 0S0 0 0KH-|MN@p t x |0 p00L0 L000P0 00 040 0<0 <080 0S 0 0S 0 |0.0T0 p00000S p00000p*E0S 7?OsP00X0 p00000S p00000p<0S 7?O[P0$0P 8  0 0001 l0Kp C@ @0S @0D00 0,0 L0 ,0,00\0 L0 ,0,000@0S \040 L0 ,0,00 \04000 0(0 00S 0$0 00S 00pD0S 7?O00s 00 00000 000Sq $00$0 L0000@0S 00L000 000`0 `0L0SZ|00S`00<SS|00S `0x0sM |0 0S `000SF t0S t0 `0R@l 00010  l 00010   l 00010   000   0R: 0001 l0Kp }E@ @0S 00 0 0 0s 0 0 000 0So0 $0R 00p)  $0F0$  00S 00p;0S 7?OE@0S0|00S P000S 0S& 0 '(00(0 0000 \08 (0R ,00,0 P0$ ,0R0S 0Sl0 `80B|00S  x0Rx00 p00S p7E@ @0S0H0 H0<0 <0(0 000 ( 0R:0(0 <00<0 p \Bl( 0001000 0S 00d0 d0S pdC0S 7?O00s 00 00000 "0l( 000100Q 0l( 000100Q 0 0s 0 0 000 0S0S 000Sd0S pd:0S 7?O000C00 l( 00010 :00@0S00S <0Sd0S pd:0S 7?O\T0S000C00 l( 00010 000s 0 00@0s 0 000Cs 0 00S( d0S pdt:0S 7?O*0D0 p AD00D0 00S D0Sd0S pdB0S 7?O X0S 0 0R 80080 8 X0R 080 ph h0S @0Sh0@0 000 00S 000C00 l( 00010 00S7000S2 L0000@0S 00L000 000`0 00L` 0]@ ph h0S @0S h0@0 l0pA0S 04  @0K`5`H-,M 00S 00(70S 7?O" 0 0 0S00S 00(j70S 7?O 000 0000 0Sl0K(H-8M( , 0 00 (000 00SH(0000 (0000@0S 000(000 00000 (0000@0S ,00(00 ,000 A00O!#"020 c0002 00 00S 00q?0S 7?OT(0000@0S ,00(000 ,000 K  0> 0S# 0  K  0e> 0S0; 09 0S 0S0 0 0>?00S00S 0060S 7?O 0KH-M  00 0 00S 00?0S 7?Ou 0 00 ^000SV 00 0 00S 00v60S 7?OX0S6 000 00S$00S 00>0S 7?O?00S0 H 00S 00G60S 7?O)00(; 0S 0k= 0S 00 00 0S 00S 0060S 7?O0K-M  00 0 0 0 00R*00 00R00 00R*00 00R00Ћ/H-(M10 $ (   R !0,@0b 0S 00S 0000S 0010S ^70K 080S00 0K  < 0S 09 00S 00H0S 00H0 2S 000 0S 8000 0S $(  0S : 0S 0S00 0S 0  0KaH-HM(208 < @ 8       @ R @ < R< dR8!0< J@0h00 00 00 0 0 0 0,00 0 0h0 00 0 0, ,0K  4,0 00 00 0 0$ 0R0S 0S03 0R 00c0$0 <0 51E2(0 $ (0R:0( $00c(0 00K0008( 0*4 0 00 0 @0S 00 @0 0Ka-M 00 0@0S 000 0<S 090 000CS000 0Ћ/H-M 6<- M 00/S00Ћ/0H- M`A@  0S 0000 0S000 0S 000S*00d0S P00d03/00 PZ600 00S: 0S 00 <x00 0400 P0003/000S,00L? 00 K0dPa\a0H- MA@ $ ( 0S 0000 (000 $0S$00$0 0S 040S50S $( <0?100S (P000$3/00(P$400(00S: 0S 00 ?< |00 $0U400(P040$3/000S ,00> 00 K0 daaH-M00   R     R  ( R 0(03/ 8  T R $ 0T03/=KLdH- M  0 6000 0K : 0S 00 3 0  0KH-M   0 0 0  : 0S 000 :0KH-M@@  0 0S000 00d0S 00d03/ (500 0S9 0S 00 };800 030 0  0K茿dPaH-$MA@ $ ( (000 $0S$00$0 0S $( n:0)000S 000$3/ $3 0S|9 0S 00 3; 800 $0I30(0  0K茾daH-M`00   R  @  T R , 0T03/<KddH-M     30KH-4MA@0 4 8 00 d00 4020S 5 6 0 S 0S 0S 0S00C0 0S00 d00 40{20S 5 6 0 S 0S 0S 0S00C0 0S0S X00$0 0D00 $0E=600790(0 K谼aaH-MT1 0S0KH-M  00  h2 0K-0Ћ/- M00 0Ћ/-0Ћ/-0Ћ/H-JM MC@  $ 4 4 0 4S 400 0 0S 0|00S 30$<30L0S 20L0 3/0d4$ $0S1000 00 00 ~20 (0=K 0C 0C4400 d00 =K 0C 0C Ky50S 4 6, ,0 S ,0S ,0S ,0S00C0 0S0S 5 X0: S 4S7 0: S5(00.S (00S/ (00.S(00S)  0R 0d00 0!0K ; 0S((0 010 7 0S000 $<( (0Sz$6 4 0  00S 0 9$0S $x60KadaH-M00   x  H R d 0H0 3/00C0 01 00{90S u9KtdH-000H-30H-000S %9000H-M 0 0S7?OQ0000KH-M   *;0 00C  600C 0 0K- M 0Ћ/H-MB@  0  700 d00 0KX40S 3 4 0 S 0S 0S 0S00C0 0S0S $20 0Z;40}#K0(0 (0K0 00 0 0 000 000 00C0 0S)K0(0 (0K0 00 0 0 000 000 00C0 0S0SI (0K15(0K0 00 0 0 000 000 00C0 0S00<0S 0 $0K 7$0 00< 00<0a;*>x  <0l00<00 00 0 0 000 000 00C0 0S0K耴bdH-LMA@@ D $K@0S @0000 0S 0|00S D0 0S @10810L@(:$K#K 0"K0S 003K03K00 d00 D00S 00< K/0S 2 30S00C0 0S0S03 0 S 0 S @(00 h:0K|bb b@bH-MA@ $ 0S 0000 $0000S 0L0S 0|00S $00 !  :10X0S 00X0$  3/ !00 d00 $0060S <2 3 0 S 0S 0S 0S00C0 0S0S 000 :t3 0K谯Hbd\bH-M@@  $0 / 0S k10 $0R* 0 0:0 0 800 090 0 0Kdb0H- (MC@( , 0 40 0K(4 2 0S 0 00(, F5 0S(0S2 (00S (00( 70S 7?O 0 0( p  (0p0  0 (0p (00S (00(.0S 7?O 0 0  r 0 L20p0S P420p0,04 3/000shx102 s00 00 700 P,04 700 00s 00 *]102 0SS 0#>0@0S F5SJ 00( b5 000 0cS00C0 000 0S0S0 001. 0s 0 00 %.0s 1 (00 8k2  0 0  r 0 0 0  0(00 K0<dbH-MB@ $ 00 0SJ 000 $00S 0|00S $00 \"  8$0000s0S0 00S 00 60S 7?Oz$00S $00$   $0 0p $00$  00S 00 -0S 7?OX$0000S; \10D0S H10D0$  3/ !00 d00 $00 30S ~0 1 0 S 0S 0S 0S00C0 0S0S 00 B81 $0000S $00  T-$00S $00 5 $50K萩bdbH-DMD@0 4 8 0000 p400S! 40(00$0 L404080 40$0K30S . t00 x6/0(0S $00  + 0S 00Kdcd@dH-(M    0 00h0S 000 h00h00 0200 00<S 0<0 000S 000 00 0S 0 00 000S 000 000S 000 000S 000 0Ћ/- M(00 0 D 0Ћ/td- M(00 0 H 0Ћ/0d- M(00 0 L 0Ћ/d- M(00 0 P 0Ћ/ᨙd- M(00 0 T 0Ћ/dd- M(00 0 X 0Ћ/ d- M(00 0 \ 0Ћ/ܘd- M(00 0 ` 0Ћ/ᘘd- M(00 0 d 0Ћ/Td- M<00  0  h 0 l 0Ћ/d- M<00  0   0  0Ћ/ḗd- M(00 0 t 0Ћ/`d- M(00 0 x 0Ћ/d- M(00 0 p 0Ћ/ؖd- M(00 0 | 0Ћ/ᔖd- M(00 0  0Ћ/Pd- M(00 0  0Ћ/ d- M(00 0  0Ћ/ȕd- M(00 0  0Ћ/ᄕd- M(00 0  0Ћ/@d- M(00 0  0Ћ/dH-(M10 $ ( R    R  |  R l!0$ b300 d0 0 $^*0S + , 0 S 0S 0S 0S 00C 0 0S0S ,0+(0S' 00 d00 (0$,0S i+ , 0 S 0S 0S 0S00C0 0S0S , 0K踔|dH-4MB@( , 0 40 00 (0S (0000 0 00 0S 0|00S ($20, 2(204 32 0S 0t400S 0@00 400S 000 400S 0:0 40 0S000 40<S 0<0 0S (000S 400S (,) 0S 0; 0K0(, 0M- 0S 0.40@0S 0 0  r 0 400S 400s0S 0 01400S 0 0  r 0 40<S (, ' 0 0KܒddH-M   0S 0SX+ 0 00 0 0S  0 KH-,MA@ $ ( ,0 0S 0000 0S 0|00S 10$ (02 0S 00S 0000S 0010S (0@100S 000$(3/ 00 d00 $(00S +* + 0 S 0S 0S 0S00C0 0S0S ,0S(00 400 $01]+ 0K訏dddH-.0S00H-M@@ 00 00 0S 00  10S 00 000 00S0 /0R00 000 00S0K舍d0H- 0MD@( , 0 40 (0S (000 0 0 0!K0 0S 400 0 " 0!K!K,0S SQ 30|0S00(0 00( 0S 0|00S 000  (#  011(0S (00S (0000S (0010S('030t0S 20t00!K  /300SB 0D  80S 800S 80000S 80010S8%0200<  @D 3/ D0R O' @0D  8<" )/( 800$0 $0 0S $0 0$ 3/0u@00 00 I80S 800S 80000S 80010S8%0Y00 d00 <0 D00c )( (0S' \(, ,0 S ,0S ,0S ,0S00C0 0S0S (0 00 (0 00  D0R:0D  0S 0D  b 8`  .&( 80000 00 0S 00 00 3/0KTdedeH-DM,B@0 4 8 <0 00S 00000 40$0 40$ <080 0 " 0 0"K0S 0|00S 40 $00lB.d100S P10400 "K1/ '00 d00 400 "K|& 0rs]& '( (0 S (0S (0S (0S00C0 0S0S 40<  408  40 $08  <    0,  .' 0K蜀ede-M 00 Ћ/H-MtA@  0S 0000 0S 0|00S  10 -10P0S 00P03/0300 d00 0K&0S % 9' 0 S 0S 0S 0S00C0 0S0S !'0 0S t0: S  0 0K(~edpK-Mb`  0 20`0S 10`00  0K 0C 0C(0 (0K0"  ;9' 0S 0(0S (00SKA>K 0C 0C(0 (0K0"  ; ' 0S 0(0S (00S4A>K 0C 0C(0 (0K0("  ;' 0S 0y(0S (00SA>K 0C 0C(0 (0K0!  ;& 0S 0`(0S (00S ( 0H00 !(0JD100 $0K0 #0S $0S 0H00 (04000 $0K0 "0S $0S 0H00 '000 0 $0K0  "0S $0S 0H00  '00H00<   '0K\zeeef ff$f,fH-4MB@0 4 8 <0 00S 00000 <080 0 " 0"K"K0S 0|00S 40 $00l+00S 000S 00000S 00010S0"0>10\0S 00\400"K1/ "00 d00 400"K+0S # <%( (0 S (0S (0S (0S00C0 0S0S $00,  +% 0Kv0fdLfH-$M@@( , ,0 (0S (0000 0K (0K( :&0 0 "0 " 0K0"0 P0040S<00 4 +)0 0"0 ,0  KtdH-,MB@( , 0 (0S (0000 0S 0|00S (10, $+0S 00S 01<S (,< (0S (00S (0000S (0010S(!0>100S 000,3/ 00 d00 ,$'0S '# }$ 0 S 0S 0S 0S00C0 0S0S e$ 0S (000 ,0* 00 0Ks\fdpfH-M00      =)B -B ?" @Qd  R P 00 3/ 0S0S   #KqdH-,M@@ $ ( $00 (000 0K0 0 #0s " $0S 00 *Kp|fH-xMH40h l p h      h @ R h   $0 7&0p R0S#0 4)000S 0000S 0010S 0080S0`0 `0K x& 0S 000S 00H0S 00H0 2S 000 0S  0{ 0S 00 <0K8 ' 0Sz<08 W&h00S h0<0 <00#$p00s0S h00"80K <&\0K80 000 < 0 ` h0@08K ' 0S 6?ORB40 SA4 80K 1& 0S94000 8 \0KR 80\ K <%K <h0!!<h0#!<h0""<h0""<0h 0 0 <0h  4 < l0 8 \0KR 80'0S # 0S 0S0 0 `0S `0  0K8pfH-(M420( , (      ( @ R (   !0 %0r0S 00S 0000S 0010S0[080S0 0 0K l% 0S 0I00S 00H0S 00H0 2S 000 0S  0o 0S 00 (,5 0S ,00S (, 0S0S C# 0S 0S0 0 0S 0  0Kkf-00 0Ћ/i8H-XM`E@` d `0000 0K`d $ 0S 0C 0P 0 000S" 00Nn 0 1Y8n 0`p 0 000;n 0o 0o00 X$  $0(0 (0,0 0$0 0 ,K 40 ^,0K40 30U,0S ( ,0R ,0#  6(,0%0(0 (0,0 0$0 040 4080 000 0!8K \30 .80KD30 D30%80S 4 80R 80#  (80%040 4080 000 0@0 @0D0 0<0 0!DK 20 D0K20 20D0S @ D0R D0P"  'D0}%0@0 @0D0 0<0 0L0 L0P0 0H0 0!PK 10 P0K10 10P0S L P0R P0!  'P0M%0L0 L0P0 0H0 0X0 X0\0 0T0 0!\K 10 \0K10 10\0S X \0R \0   v'\0%0X0 X0\0 0T0 000   00b' 040 x    d00R!`00 0d&0KTif(g0g4gPgTgpgggggg8-M  00 0 0 0Ћ/H-$MA@ $ ( $000 $029S $0010 #0](0S 0K 1  0S H10 %0H0F0$  0! | 0 ! 0! 0  0  0  0  0  0  0  0  0  0  0|  0p  0     0 0Kpcg0\ܾdL,8H-MM@  0 00 0 00$0 00 0<0 0@0S 000p=0 s"0$0S $00S $0000S $0010S$70$080S000 00K$ "( (0S (0$00S $00H0S $00H0 2S 000 0S 0S00   0S 00 @$<0 4R% 0S$00S$;0J&00 )40K  0S 027S 00;0#$ 400S $\;0(&00 00S 00h0S $;0&00$ "# 0S0\0 R"$000S 0 0\ 0,t 0\0$  # 0S0@ t 0 ` 0` 0d 0 0 $? 0S0@0 "0 0@0$ 0" 0S0@0 00 0 0H 0H 0D 0,X 0 0@0\ n# 0S  6?OR 0`0 S0@ t 0 \  6?OR  6?ORl00Sh $00S $00H0S $00H0 20s0S 029S$`80[# K00 000 000S 1! 1!000S00 0 0 00!QQP P0 QQ PP$|70.%00 $000S=0\ 00 80K \ 80K0 \  80K0 \  80K0 \  0\08 K 0\008 K 0\008 K 0\008 K <0K \  <0K0 \   <0K0 \   <0K0 \   0\00< K 0\000< K 0\000< K 0\000< K 0\0 $K0\00D K 0\000D K 0\000D K 0\000D K 0\000D K 0\000D K 0\000D K 0\000D K 0\0!$K0\00L K 0\000L K 0\000L K 0\000L K 0\000L K 0\000L K 0\000L K 0\000L K 0\0!%K0\00T K 0\000T K 0\000T K 0\000T K 0\000T K 0\000T K 0\000T K 0\000T K 0S 022S 0 0K$  0S00 0 0@0\ q 0S $10#00s0S 0;S 00 0`0S$l10#00 $000S 0\0 0 0\00 00S$00S $00H0S $00H0 20s0S 029S$00g! W0 $000Sg0S 022S 0 0K$  0S800 @ahhihH-M00    @ R    P 0 0 00!  00! 0KL=iH-M !K0000 0@0S 00000 X0% 0R 0R 0R  0Rd00}00!K!0 !00     0K<iiH-tMI@h l p t0 h000 00 0 p0S022S p0K l  0S 000 00 p0 0H 0Sp h0@0h\l 0S  6?ORh0`0 Sh0@ t h0 \ 000S h0\0 h0 000Sh0 h0\0 ^(0Kh  (0K0h   (0K0h   (0K0h   h00( K h000( K h000( K h000( K ,0Kh  ,0K0h   ,0K0h   ,0K0h   h00, K h000, K h000, K h000, K h0!#Kh004 K h0004 K h0004 K h0004 K h0004 K h0004 K h0004 K h0004 K h0"#Kh0 0< K h0 00< K h0 00< K h0 00< K h0 00< K h0 00< K h0 00< K h0 00< K h0"$Kh0(0D K h0(00D K h0(00D K h0(00D K h0(00D K h0(00D K h0(00D K h0(00D K h00$0 $000SQh0`0S 3000 Vh00 t0R000 $000S` $00 ? 0 0$QQPP$00 ? 0$0!QQPP t0Rt00 $000S $0!$ 1000 $000Sq$00 ? 0$QQdPP`$00 $0 Z$00 ?P 0$0 QQPP$00 ?P 0 0$QQPP t0Rt00 i$000S $0!$ $000S$00 ?P$0 Q Q PP;hj,j$00 $0 00c0 $00 ? 0$ 000S=h0\ h00 YH0Kh \ H0K0h \  H0K0h \  H0K0h \  h0\0H K h0\00H K h0\00H K h0\00H K L0Kh \  L0K0h \   L0K0h \   L0K0h \   h0\00L K h0\000L K h0\000L K h0\000L K h0\0 %Kh0\00T K h0\000T K h0\000T K h0\000T K h0\000T K h0\000T K h0\000T K h0\000T K h0\0!%Kh0\00\ K h0\000\ K h0\000\ K h0\000\ K h0\000\ K h0\000\ K h0\000\ K h0\000\ K h0\0!&Kh0\00d K h0\000d K h0\000d K h0\000d K h0\000d K h0\000d K h0\000d K h0\000d K p h0@0h\l` $00 ? P0$ 0S 50$$00 ? 0h#$000S h0 0 0h# h0 0 0h#0S p 00  000KH-F0 0 0c10  0 "0 "0040!00!000!000 0= 0 ;>F00 0c10 0 "0 "0 080!0 0!000!000 0= 0 ;>F00 0c1 0   0 "0 "00<0!0$0!000!000 0= 0 ;>F00 0c10  0 " 0 "000!0(0!0 00!0 0 0 0= 0 ;>F00 0c10  0 "0 "000!0,0!0$00!0$0$0 0= 0 ;>F0 0 0c10  0 "0 "000!000!0(00!0(0(0 0= 0 ;>F00 0c10 0 "0 "0 0 0!040!0,00!0,0,0 0= 0 ;>F00 0c1 0   0 "0 "0$00!080!0000!00000 0= 0 ;>F00 0c10  0 " 0 "0(00!0<0!0400!04040 0= 0 ;>F00 0c10  0 "0 "0,00!00!0800!08080 0= 0 ;>F0 0 0c10  0 "0 "0000!00!0<00!0<0<0 0= 0 ;>F00 0c10 0 "0 "040 0!00!000!000 0= 0 ;>F00 0c1 0   0 "0 "080$0!0 0!000!000 0= 0 ;>F00 0c10  0 " 0 "0<0(0!00!000!000 0= 0 ;>F00 0c10  0 "0 "00,0!00!0 00!0 0 0 0= 0 ;>F0 0 0c10  0 "0 "0000!00!000!000 0= 0 ;>F00 0c10 0 "0 "0040!00!000!000 0= 0 ;>F00 0c1 0   0 "0 "0 080!0 0!000!000 0= 0 ;>F00 0c10  0 " 0 "00<0!0$0!000!000 0= 0 ;>F00 0c10  0 0 00 000!0(0!0 00!0 0 0 0= 0 < ?H0 0 0c10  0 0 00 000!0,0!0$00!0$0$0 0= 0 < ?H00 0c10 0 0  00 000!000!0(00!0(0(0 0= 0 < ?H00 0c1 0   0 0  00 0 0 0!040!0,00!0,0,0 0= 0 < ?H00 0c10  0 0 00 0$00!080!0000!00000 0= 0 < ?H00 0c10  0 0 00 0(00!0<0!0400!04040 0= 0 < ?H0 0 0c10  0 0 00 0,00!00!0800!08080 0= 0 < ?H00 0c10 0 0  00 0000!00!0<00!0<0<0 0= 0 < ?H00 0c1 0   0 0  00 040 0!00!000!000 0= 0 < ?H00 0c10  0 0 00 080$0!0 0!000!000 0= 0 < ?H00 0c10  0 0 00 0<0(0!00!000!000 0= 0 < ?H0 0 0c10  0 0 00 00,0!00!0 00!0 0 0 0= 0 < ?H00 0c10 0 0  00 0000!00!000!000 0= 0 < ?H00 0c1 0   0 0  00 0040!00!000!000 0= 0 < ?H00 0c10  0 0 00 0 080!0 0!000!000 0= 0 < ?H00 0c10  0 0 00 00<0!0$0!000!000 0= 0 < ?H0 0 0c10  0 0 00 000!0(0!0 00!0 0 0 0= 0 < ?H00 0c10 0 0  00 000!0,0!0$00!0$0$0 0= 0 < ?H00 0c1 0   0 0  00 000!000!0(00!0(0(0 0= 0 < ?H00 0c10  0 0 00 0 0 0!040!0,00!0,0,0 0= 0 < ?H00 0c10  0 "0 "0$00!080!0000!00000 0= 0 1 b:L0 0 0c10  0 "0 "0(00!0<0!0400!04040 0= 0 1 b:L00 0c10 0 "0 "0,00!00!0800!08080 0= 0 1 b:L00 0c1 0   0 "0 "0000!00!0<00!0<0<0 0= 0 1 b:L00 0c10  0 " 0 "040 0!00!000!000 0= 0 1 b:L00 0c10  0 "0 "080$0!0 0!000!000 0= 0 1 b:L0 0 0c10  0 "0 "0<0(0!00!000!000 0= 0 1 b:L00 0c10 0 "0 "00,0!00!0 00!0 0 0 0= 0 1 b:L00 0c1 0   0 "0 "0000!00!000!000 0= 0 1 b:L00 0c10  0 " 0 "0040!00!000!000 0= 0 1 b:L00 0c10  0 "0 "0 080!0 0!000!000 0= 0 1 b:L0 0 0c10  0 "0 "00<0!0$0!000!000 0= 0 1 b:L00 0c10 0 "0 "000!0(0!0 00!0 0 0 0= 0 1 b:L00 0c1 0   0 "0 "000!0,0!0$00!0$0$0 0= 0 1 b:L00 0c10  0 " 0 "000!000!0(00!0(0(0 0= 0 1 b:L00 0c10  0 "0 "0 0 0!040!0,00!0,0,0 0= 0 1 b:L0 0 0c10  0 "0 "0$00!080!0000!00000 0= 0 1 b:L00 0c10 0 "0 "0(00!0<0!0400!04040 0= 0 1 b:L00 0c1 0   0 "0 "0,00!00!0800!08080 0= 0 1 b:L00 0c10  0 " 0 "0000!00!0<00!0<0<0 0= 0 1 b:L00 0c10 h0 0 h0 h00h    h00h    h0 0h    h00h    0 0 00 00 00 00 K- M  3E7F0 ; ?N0 < 8I0 v420A 0 13L00  0 0 Ћ/H-M   001?0 0 0 01 0 0 01R*00 0 0 0> 0 00?S#0 00 @ b   00l  00d0@00 0? 0R:0 0 00 0 0 0 00c KH-MA@ $ 00 0S00$ 0! 0 000123s 0 K0 000 0S$010 $10 $00~? S0K$ 00  00 "$    !1"r 000 0S00 $00@ $0 $00 0K $ $00K@kDkH-4MB@( , 0 40 (000 00S20+ 0204 /> 0S 000L204 !0 0S 000204  0 0S 0u,0S ,00:S 40;S 10^ 0b0S 00S 0000S 0010S0K080S0 0 0K p 0S 09,0S00S 00H0S 00H0 2S 000 0S  0S 00 04  , 00 0S 0S  0S 0  0KHkTkH-(M $ ( ,0 ,0 0K   0S 0C 00 0 0  0(  0 @ 0 @ D 0 H 0 H L 0 P 0 P T 0  $0S(0S (000$0000S 0  * /00s0S 0  @ $0 0S 0  )  01:S 0  @  018S 0  ) 0  * 00S 019S 00S0  0;S 0  , 0<S 0  + 0;S  019S(0S (00:S 0  * 0y 0S0 00 (0SQ (0 00 0( @ X X0S (0@0 X \ 0X (0D  (0@ 0( @ \ 0L0s 0L 0L000c 0T 0L0 0L0 0T0s 0T0T0c0X0 0T0 0L0 c0P 0 T  0L0 c0L 0L0 0 c0X 00S- 00 00 (0S (0 00   0S0(0 00 0S(0S080S 0 080  0 0S ,0 0 0 0KH-M  0 0 0 @ 0@ 0D 0 H 0H 0L 0 P 0P 0T 0  0 0 h 0$0  0(0  0KH-0M( (000 0000 00!$0K(  0S 0O0 0 0h0s 0h0 0h0000 $  010  00 0 0d0s 0d0 000 0S0! 0 0S $0 0 0 $0((00S 000 0K ( 0 0KH-M  0K  0S 0" 0  0 @ 0 @ D 0 H 0 H L 0 P 0 P T 0$ 0 00KH-,M8G@0 0000 000 000 000 0 00000S 000000S 7?O0000S  0d00s0S 6000  00s 0 0s 0! 0 0 0R8 0Si0 (0K  0S 50^[ 0h0s (0 h h (  b d 0h0 0h0 (0d0s (0d0d0c0h0 (0d0 0h0 c 0l (0 d (0 0h0 c 0h (0 h (  bh 00 0 00$0 0<0 0< 0D0 0D 0D 0L0R 0D 0L (0$  0<0( (  3/00S 0 000$ s 0S(0  (0  (0  (0  (0 L (0 P 000S ( 000@0S 000 0000 00,00c 0(0 (0 $ (0 4 (0 8 (0 < (0 @ (0 H (0 D (0 \ (0 ` (0 l (0 ( (0 , ( 000@0S (00(000,00c0000000S 00000{0S 7?O00$  ( 00 00$" l 00" p 00 " t 00" x 00! | 00! 00! 00! 00! 000S 00S 000 00 0  0S 0J000 0S, 00S 000S 7?O600 0 0 004 000  000 0 00S 000S 7?O000000S 000000S 7?O0Kkk2'7@|Z`H-M010             l p t x |  000 0`00S 00+0 00 00  0K|2'7@|H- M $ 000 0 00S000 0S 00S 0000S 0010S 09 080S00 0K   0S 0' $ 0S 00S 00H0S 00H0 2S  0S 0S00 0S 0  0K0H- xMH@p t p0000 p0 00 p000S p" p 0S 0p00S-00S) 00H0S$ 00H0 2<S 00S 00H0S 00H020S V 0S  6?OR00 000 00 0 00$0 ,70t %00S 0t0 !0060t 00S 0t0 t0 0S p00:@0p 0p00)p0 t00s0S p00:@0p 0p00@ p0 t00S% p00:@0p 0p00*p0 (t 0S (, ,0S ,X0mp0@0(0 (0Sp0@0(0 (0S00S 00S 00H0S 00H0 20S00S 00L0@0S00S00Sp0P0S p00Sp 0 0Sh0K l00S, 0h0 00S 00H0S 00H0 2<S 00S00S H0K IH0K\0 p0 h0K 1 0S200S00S* 0` h R !04V    R R (    Q 0I \ R  `  R  !0 0604  R  00) \ R R  R  00 \ Rl  d  \00 0K|k`lllllllH-XMP T P000 000 0000 0 0 T0S 00P 09 0S  000S7 P00S0P0 P00  0S  {0P00S T0S00L0 0@0 P0 L0K 0S  Z0rP0 00 0(0S P 0S  G0_0H0S 0<0s0@0s0<0 0@ 0S  +0C00000S 000000S 7?O0T0S 00 \00d0s 0d0 0 h d  b h  0h00 h   d  0h 0h00c 0l  0h00 0`00S 0 0 C0 0 0S00 0 0$0S 0 000@0S 0$00,0$00C0 $ P00S3 P00 0$0 0T0s 0T0 0 X T  b X  0X00 X   T  0X $0L00c $0P  0X00 z0D0(0 (0St (0S (0S 7?O0H0SG 0p0s 0p 0p000c 0d 0p0 0p0 0d0s 0d0d0c0h0 0d0 0p0 c0t 0 d  0p0 c0p 0p0 0 c0h 0H0 0H 0H 0P0R0H 0P 00 (0S ()0S 7?O-0S 0D05 0S  00S 0,0S 0 000@0S 0000,0000s00nT0S 0@0 0@ 080 08 0D0 C0D 00000S 000000S 7?O00S 0 P00 0S  0P00SC P0X0S P0X0P \ \ P00P \ D P0\0P X /P0P ,0R P0P0 P0P P0P0SP0P P0T P0P00 000 0 ,0R00 0 00S P0T ,P0P0,0 ,0SP00S P00P0  P00 0S3 00S 000S 7?OTP000S P000P 4 4 P04 0 P040P 0 00S 00.0S 7?O2P 0S+ x)00S 00H0S 00H0 2<S 00  P  P 00  L L 0  0e0KH- M   0 0 0 0 0    0  V7?OR00 0 00 0S000s0S 00S 00S 0 0KH-\MDC@X X000 00 0 0D0 0P0 00 00S0@0K X000 000 0S 00S0S 0,0S 0,0P0 X0,0S X0,0P0 X00 P K  0  0S 00S P 0, X0P00 00@0 0<0 0L0 0H0 P@ KL0K XX 0S 10 D000 0SX0 0 L0K L0SH0S( D0K  0S" (DL K@0K 0G 0SP@ KL0K X 0S L0H    nL0SH0SD0S D0$ $0S 0S$00 0SP0S P0 -0Km@mH-Mp00      R  R0  @ R $ 000K耩pmH-Mx | x000 x00S 00 00 |00 \0K| |00\ K  X 00c0 0 0 x00S 00 0 00 00(0 |00x 00 0 000S00  000  000  000  00   00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 00 000S00  000  000  000  00  00 0 0  00 0 0   0 0KH- M  0K  0S 0c0 0 0 8  00 z000S0  00  00  00  0  o 00 0 000S00 0  00 00  00 00  00 00  00 0  A 00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S00  000  000  000  00  00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S00  000  000  000  00  v 00 0 00 W000S0 0  0 00  0 00  0 00  0 0  G 00 0 0  0 0 0 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0X0 00 00 l00S d0S0Hd0S0C0 0 0 0 d0S0\0 D0K<0 0@0 @0D0 ;d0@0S X0`d  0S 0#d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0\0 0S 00 0 040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 040 L0K`  0S 0L0080 0S 8 400c0 k800 `000SX0K0 0 00X K 00X K 00X K X0K ^000 `000S\0K0 0 00\ K 00\ K 00\ K \0K :000 `000S<00 0 00<  00<  00<  <0 `000S00<   00<   00<   00<  0 <00 000 `000S00 0 00  00  00 0 000 0T0 `000ST0K0 0 00T K 00T K 00T K T0K 000 `000S 00 0 00  00  00  0 000 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K V000 5`000S000 0 00   00   00  00 ,000 0 00 !00 00 0Sd0SHl008 K` 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0   0Sd0S80`0KH- M  0K  0S 00 0 0 (  00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  a 00 0 000S00  000  000  000  00  8000S0 0  0 00  0 00  0 00  0 00  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 k 00 0 000S0K  0K0  0K0  0K0  0K  G0  00 0 000S0$0  0$00  0$00  0$00  0$0   00 0   0 0KH- M  0K  0S 00 0 0 ,  00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  |000S0 0  0 00  0 00  0 00  0 00 S 00 0 000S00  000  000  000  00  *000S00  000  000  000  0 00  00 0 000S00  000  000  000  00  000S00  000  000  000  0 00 00 0 000S0K  0K0  0K0  0K0  0K  0  00 0 000S0$0  0$00  0$00  0$00  0$0  _ 00 0 000S0(0  0(00  0(00  0(00  0(0  6 00 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0T0 00 00 l00S d0S0d0S00 0 0 0 d0S0X0 D0K<0 0@0 @0D0 ;d0@0S T0`d  0S 0fd0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0X0 ,040 `00S `0004 3/ 4 0040 0Sd0S 4 80K`  0S 040 L0K`  0S 0 L0080 0S 8 400c0 i800 `000ST0K0 0 00T K 00T K 00T K T0K \000 `000SX0K0 0 00X K 00X K 00X K X0K 8000 `000S<00 0 00<  00<  00<  <0 `000S00<   00<   00<   00<  0 <00 000 0SJ `000S00 0 00  00  00 0 `000S00   00   00   00  0 00  000 0SJ `000S00 0 00  00  00 0 o`000S00   00   00   00  0 00 F +000 0P0 `000SP0K0 0 00P K 00P K 00P K P0K 000 `000S00 0 00  00  00 0 000 `000S00 0 00  00  00 0 000 0Sd0SHl008 K` 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0   0Sd0S80`0KH- M  0K x 0S 0.0 0 0   00 N000S0  00  00  00  0  C 00 0 000S00 0  00 00  00 00  00 00  00 0   00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 00 0 000S00  000  000  000  00  00 0 000S00  000  000  000  00  q000S00  000  000  000  0 00 H 00 0   0 0KH-`MX \ ` d0 0L0 L0L0 `0H0 0P0 00 00 d00S \0S0\0S00 0 0 0 \0S0T0 D0K<0 0@0 @0D0 ;\0@0S P0X\  0S 0\0 00 00<0 \0000@0S 0 0\00,0 0 000 0 0S000 00S00S0H0 \0 0T0 040 X00S X0004 3/ 4 0040 0S\0S 4 80KX  0S 0w40 L0KX  0S 0jL0080 0S 8 400c0 {800 X000SP0K0 0 00P K 00P K 00P K P0K n000 X000ST0K0 0 00T K 00T K 00T K T0K J000 X000S<00 0 00<  00<  00<  <0 &X000S00<   00<   00<   00<  0 <00 000 X000S00 0 00  00  00 0 000 0SJ X000S00 0 00  00  00 0 X000S00   00   00   00  0 00  n000 0S\0SHd008 KX 0S0\0S* <0H H `0R$ H `0 00 L0\ P 0SL0 \0T L \0P \0 0\  `  ` `0 `0   0S\0S80XR0KH- M  0K ) 0S 00 0 0 `  00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  00 0 000S00  000  000  000  00  000S0 0  0 00  0 00  0 00  0 00 t 00 0 000S00  000  000  000  00  K 00 0 00 ,000S00  000  000  000  00   00 0 0  00 0 0 000S0K  0K0  0K0  0K0  0K  0 0 00 0 000S040  0400  0400  0400  040  00 0 000S080  0800  0800  0800  080  00 0 000S0<0  0<00  0<00  0<00  0<0  r000S0@0  0@00  0@00  0@00  0@ 00 I 00 0 0D0 *000S0H0  0H00  0H00  0H00  0H0   00 0 0 D 0H0 0 0   0 0KH-hM` d h l0 0L0 L0L0 h0H0 0X0 00 00 l00S d0S0)d0S0$00 00 d0S0\0 D0K<0 0@0 @0D0 ;d0@0S X0`d  0S 0d0 00 00<0 d0000@0S 0 0d00,0 0 000 0 0S000 00S00S0H0 d0 0\0 0S 000 0 0S 000040 `00S `0004 3/ 4 0040 0Sd0S 4 80K` p 0S 040 L0K` c 0S 0L0080 0S 8 400c0 680 0 `000SX0K0 0 00X K 00X K 00X K X0K  ) 00 0 `000S\0K0 0 00\ K 00\ K 00\ K \0K   00 0 `000S<00 0 00<  00<  00<  <0  `000S 00<   00<   00<   00<   0 <00 00 0 `000S00 0 00  00  00  0 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  k 00 0 5`000S000 0 00   00   00  00  A 00 0 0 00  600 0 0 0T0 `000ST0K0 0 00T K 00T K 00T K T0K   00 0 `000S00 0 00  00  00 0  00 0 `000S00 0 00  00  00 0  00 0 0SJ `000S00 0 00  00  00 0  `000S 00   00   00   00  0 00 v  [ 00 0 0S&0P0 `000SP0K0 0 00P K 00P K 00P K P0K  H 00 0 5`000S000 0 00   00   00  00   00 0 0 00  00 0 0 0Sd0SHl008 K` 0S0d0S* <0H H h0R$ H h0 00 L0d P 0SL0 d0T L d0P d0 0d  `  ` h0 h0  0Sd0S80`0KH- M  0K  0S 00 0 0   00 000S0  00  00  00  0  00 0 000S00 0  00 00  00 00  00 00  00 0  S 00 0 000S00  000  000  000  00  *000S0 0  0 00  0 00  0 00  0 00  00 0 000S00  000  000  000  00  00 0 000S00  000  000  000  00  00 0   0 0KH-`MX \ ` d0 0L0 L0L0 `0H0 0P0 00 00 d00S \0S0\0S00 0 0 0 \0S0T0 D0K<0 0@0 @0D0 ;\0@0S P0X\ h 0S 0\0 00 00<0 \0000@0S 0 0\00,0 0 000 0 0S000 00S00S0H0 \0 0T0 040 X00S X0004 3/ 4 0040 0S\0S 4 80KX  0S 0F40 L0KX  0S 09L0080 0S 8 400c0 800 X000SP0K0 0 00P K 00P K 00P K P0K 000 X000ST0K0 0 00T K 00T K 00T K T0K 000 X000S<00 0 00<  00<  00<  <0 X000S00<   00<   00<   00<  0 <00 d000 X000S00 0 00  00  00 0 @000 X000S00 0 00  00  00 0 000 0S\0SHd008 KX 0S0\0S* <0H H `0R$ H `0 00 L0\ P 0SL0 \0T L \0P \0 0\  `  ` `0 `0   0S\0S80X0KH-MA@  10 0i 0S 0400 0\ 0S 0'00 0O 0S 0x00 0B 0S 0 H00 05 0S 00KGL<H-(M4Ÿ $ ( ,0 00 0 00S 20+ 0v 00S 00H0S 00H0 20s0S 0c 0S 00S 0000S 0010S v0L 080S00 0K   0S 0: 00S 00H0S 00H0 2S 000 0S 000 0S $( ,0 0S  0S 0S00 0S 0  0K\FmH-lMF@P T X \0 00 P000 000 0 P00$0 $00(0 (00,0 8KL KH0KP] 0S 0^\00SVH0SL0S0RT0S L0%H0#5 T0R@*X0S5 D0KP00000S P00000P0S 7?O. 0000 P00000S P00000P0S 7?OD 00cX 020b1Q X0ST0S 0 00S 00Pb0S 7?O80KP 0SP00S P00S P00H0S P00H0 2<S P00@0S 80K   P P00S 0000P 0 0S P20 P00S& P00S" P00H0S P00H0 2<S P00@0S \00S P00H0L0S P00H0L0P P00Sq P00000S P00000P0S 7?On @0K P00000S P00000PW0S 7?OV00 00 P00S P00L0@0S000  0 0S00 P 0S 80K8K@K ,   P 0E 0S 804  P  }80KP 0S 00S 00P0S 7?O0K DmmH-M  00 0 0000 00000S 00000I0S 7?O]0h0s 0h0 0h0000 800S) 00S% 0 00R 0 00R0#03s00 00R 0 00R*00s0S 0  0d0s 0d0 000 0S00000S 000000S 7?O0KH-M  000 000 0 00000S 000000S 7?O% 0K 00000S 00000E0S 7?O 0S0S6?O0 K0KH-M  000 000 0 00000S 000000S 7?O= 0 00R 0 00R0#03s0 0 00R 0 00R*00s0S 0 0 0000000S 000000S 7?O0KH-ME@ 000 000 000 0 00000S 000000S 7?O" 0h0s 0h0 0h0000 0 0S0\0S 0800   00 00( 0A 0S1 0D00 (00S (000 00 000  0S# 000  ( 0 0S 0(0 h 00 0S 00  0(0K.nH-M   0 0 0K G 0S 00S0  0  0Y7?OKH- 0 0  0S+0S 00  0S 0% 00 N 0  0 0  0 L  0L0  0 0L 0 0S 0K0KH-M   0H00 800 0 00S,0 030S&00S 00   0 0L 00  0 000S 00   00 0SKH-M   0 00S0-0 0 0K$ e 0S 0 0  0  0  0 0  0 L  0L0  0 0L 0 ` 0KH-M   0 0H00 100 0 00S 00S!0 00R 0 0R00S 00   0 0L 00   00 0SKH-HM8 < @ D0 0 0 D0S: <0H00 W00SG00SE 00SC 00SA 00S? 00K $0 K 0 000 0 00K8  0S 0 0  \ 0 0 `  6?OR00 0S 0S0 0 0 000 0S 000S 00   0 <0L 00  @0S00S00S񏐗;q0 0 j 0Sz 0Sy0 0 00S 0 0 08  0Sc 0Sb0 0 h0 08 T 0SW 0SV0 0 X00K }0 K 0 000 0 00K8 ` 0S 0 0  \ 0 0 `  6?OR00 0S 0S0 0 0 0 08 0 0S 0S0 0  00S S 00S 008K0 08F@0S0 0 ` 89<0H00 0S 0KH-0M( , 0 ,0 00 0S0(000 (000 0 00@0S 000 0800c0 000@0S 0000,0 00000 0 0 0$0 $0 0R0 00 0 $00$0 0( 0R0, 0(0R\(00000S (00000(0S 7?O[00,0!$0K 0S 0K$ 0(01 ᘹ0,0S00夼(00000S (00000(0S 7?O'000@0S $0$0 0,00c 00$00 0,0 0, 0(01 0  0(0 0( 00@0 00@ 0KH-(M( , ,0 00 0(0S0(000 (000 00 ,00S ,00 00 0 000@0S 0000,0 00000 0 0 s0 00@0S 00080 000$0 $0<0S $0<0( 0S 7?O\ 0S ,00($ 劾 $0@0 C$0@ $0<0S8 $0<0(ၸ0S0 7?O>$0@0S$0<0S $0<0(n0S 7?O+($ 0㖸 $0@0 C$0@ $0<0S $0<0(S0S 7?O0S  00 0 000 0( 0R0KH-M   00 0 0 0d 0 00S) 0 0S 00 00 d 8 80S 0d0  8 < 008 0h 0 0d 00 d < 0K-M  00 0 0Ћ/H- M  0S 00S 0000S 0010Ss0080S00 0K  0S 0  ' 0S 0  0KH-0M $ ( ,0 0S 00S 0000S 0010S 40P 080S00 0K  㽾 0S 0> 00S 00H0S 00H0 2S 000 0S ぺ000 0S0000 $( ,0ֻ 0S 埼 0S 0S00 0S 0  0KH- M  00 0S0>0S 090K`0S00 0K㾿0S 0' 000 0H“ 0%001S 0l0S 0l0S 0001S 0l0S 0& 0K ߻0S 0 0 0S 00p0 3/0S 0 0{0KH-(M  $0 0K ᢽ0S 0!$04S 00 $05S 00 00 00 0 K    00S 00KH-(M $ ( (00 0S0h0S 0c0K$b0S 0Z 0K  `0S 0O0000@0S 000,0 00 0 0l0Sf09 0l0Sh03 0l0S 0l0S 0l0S 0% 0K 00S 0 0 0S 00l0 3/0S 0 00KH- M  00 0S00S 0 0K0S 0 0K 0S 0 0 E0K-$M  $0 00 0 0 00 00 0Ћ/H-M@@  000 00S 00o0 㯺 0S 000 0S 0 0S 0 0 00O0KuvH-M@@ 0 0K 3 0S 0 00!0 ! 08  !0 pp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# & * Z>>*S 51:3`//// *& *Z>>*SJ51:3////@-ٶ -LCopyright (c) 1996,2008 Oracle. All rights reserved. %sBerkeley DB: DB 1.85's recno bfname field is not supported. Berkeley DB: DB 1.85's R_RECNOSYNC sync flag is not supported. fcntl lock failedDbCursor.close__bamc_get__bamc_put__bamc_searchNot enough room in parent: %s: page %luDB->set_flagsDB->set_bt_compareDB->set_bt_minkeyminimum bt_minkey value is 2DB->set_bt_prefixDB->set_re_delimDB->set_re_lenDB->set_re_padDB->set_re_sourceprefix comparison may not be specified for default comparison routinebt_minkey value of %lu too high for page size of %lu%s: btree version %lu requires a version upgrade%s: unsupported btree version: %luDB->open%s: DB_DUP specified to open method but not set in database%s: DB_RECNUM specified to open method but not set in database%s: DB_FIXEDLEN specified to open method but not set in database%s: DB_RENUMBER specified to open method but not set in database%s: multiple databases specified but not supported by file%s: duplicate sort specified but not supported in databaseopen method type is Btree, database type is Recnoopen method type is Recno, database type is BtreeExisting data sorts differently from put dataDB->putcursor adjustment after delete failed__ramc_getillegal record number sizeillegal record number of 0rb%swb%s: write failed to backing fileToo many btree levels: %d%sDefault Btree/Recno database information:%lx Btree magic number%lu Btree version numberLittle-endianBig-endianUnrecognized byte order%s Byte order FlagsMinimum keys per-pageFixed-length record size%#x Fixed-length record padUnderlying database page sizeOverflow key/data sizeNumber of levels in the treeNumber of unique keys in the treeNumber of records in the treeNumber of data items in the treeNumber of tree internal pagesNumber of bytes free in tree internal pagesffNumber of tree leaf pagesNumber of bytes free in tree leaf pagesNumber of tree duplicate pagesNumber of bytes free in tree duplicate pagesNumber of tree overflow pagesNumber of bytes free in tree overflow pagesNumber of empty pagesNumber of pages on the free list%lu %sOverflow sizeRecnoOrder Internal FlagsC_DELETEDC_RECNUMC_RENUMBERduplicatesrecnorecord-numbersfixed-lengthrenumbermultiple-databasessorted duplicatespgno: %luUnknown record format, page %lu, indx 0Compact cannot handle zero length key__hamc_getH_NOMORE returned to __hamc_get__hamc_putExisting data sorts differently from put data__ham_add_dupDB->set_h_ffactorDB->set_h_hashDB->set_h_compareDB->set_h_nelem%s: Invalid hash meta page %lu%s: hash version %lu requires a version upgrade%s: unsupported hash version: %luDB->open%s: DB_DUP specified to open method but not set in database%s: multiple databases specified but not supported in file%s: duplicate sort function specified but not set in database%$sniglet^&Attempt to return a deleted itemkey1: %s, key2: %s, len: %lu curroffset %lu indexes: %04X, __hamc_delpgInvalid flag in __ham_curadj_recoverCannot replicate prepared transactions from master running release 4.2.%sDefault Hash database information:%lx Hash magic number%lu Hash version numberLittle-endianBig-endianUnrecognized byte order%s Byte order FlagsNumber of pages in the databaseUnderlying database page sizeSpecified fill factorNumber of keys in the databaseNumber of data items in the databaseNumber of hash bucketsNumber of bytes free on bucket pagesffNumber of overflow pagesNumber of bytes free in overflow pagesNumber of bucket overflow pagesNumber of bytes free in bucket overflow pagesNumber of duplicate pagesNumber of bytes free in duplicate pagesNumber of pages on the free list%lu %sBucket traversingBucket lockedDuplicate set offsetCurrent duplicate lengthTotal duplicate set lengthBytes needed for addPage on which we can insertOrder Internal Flags__ham_traverseH_CONTINUEH_DELETEDH_DUPONLYH_EXPANDH_ISDUPH_NEXT_NODUPH_NOMOREH_OKduplicatesmultiple-databasessorted duplicates%$sniglet^&Page %lu: database has custom hash function; reverify with DB_NOORDERCHK setPage %lu: Impossible max_bucket %lu on meta pagePage %lu: incorrect high_mask %lu, should be %luPage %lu: incorrect low_mask %lu, should be %luPage %lu: suspiciously high nelem of %luPage %lu: spares array entry %d is invalid__ham_vrfyPage %lu: item %lu is out of order or nonsensicalPage %lu: entries array collided with dataPage %lu: hash key stored as duplicate item %luPage %lu: duplicate item %lu has bad lengthPage %lu: duplicate item %lu has two different lengthsPage %lu: offpage item %lu has bad pgno %luPage %lu: offpage item %lu has bad page numberPage %lu: item %lu has bad typePage %lu: Hash meta page referenced twicePage %lu: hash bucket %lu maps to non-hash pagePage %lu: non-empty page in unused hash bucket %luPage %lu: above max_bucket referencedPage %lu: impossible first page in bucket %luPage %lu: first page in hash bucket %lu has a prev_pgnoPage %lu: hash page referenced twicePage %lu: duplicates present in non-duplicate databasePage %lu: unsorted dups in sorted-dup databasePage %lu: hash page has bad next_pgnoPage %lu: hash page has bad prev_pgnoPage %lu: item %lu hashes incorrectlyUNKNOWN %s: data offset plus length larger than record size of %luRecord length errorDBC->put__qamc_getillegal record number sizeillegal record number of 0%s%c__dbq.%s.%d.%s%sDB->set_extentsizeExtent size must be at least 1Queue does not support multiple databases per fileExtent size may not be specified for in-memory queue databaseMultiversion queue databases are not supported%s: unexpected file type or format.%s: queue version %lu requires a version upgrade%s: unsupported qam version: %luRecord size of %lu too large for page size of %lu%sDefault Queue database information:%lx Queue magic number%lu Queue version numberFixed-length record size%#x Fixed-length record padUnderlying database page sizeUnderlying database extent sizeNumber of records in the databaseNumber of database pagesNumber of bytes free in database pagesff%lu First undeleted record%lu Next available record numberPage %lu: queue databases must be one-per-filePage %lu: queue record length %lu too high for page size and recs/pagePage %lu: database contains multiple Queue metadata pages__dbq.%s.Warning: %d extra extent files foundPage %lu: queue record %lu extends past end of pagePage %lu: queue record %lu has bad flags (%#lx)Page %lu: queue database has no meta pagePage %lu: queue database page of incorrect type %lu Not enough input bytes to fill a __rep_bulk messageNot enough input bytes to fill a __rep_control messageNot enough input bytes to fill a __rep_egen messageNot enough input bytes to fill a __rep_fileinfo messageNot enough input bytes to fill a __rep_grant_info messageNot enough input bytes to fill a __rep_logreq messageNot enough input bytes to fill a __rep_newfile messageNot enough input bytes to fill a __rep_update messageNot enough input bytes to fill a __rep_vote_info messageWalk_dir: Getting info for in-memory named filesWalk_dir: Getting info for dir: %sINMEMWalk_dir: Dir %s has %d filesWalk_dir: File %d name: %s__dbDB_CONFIGlog.Walk_dir: File %d %s: returned error %sWalk_dir: File %d (of %d) %s at 0x%lx: pgsize %lu, max_pgno %lurep_check_uid: Could not mallocCheck_uid: Found matching file.page_req: file %d page %lu to %lupage_req: Open %d via mpf_openpage_req: Open %d failedsendpages: file %d page %lu to %lusendpages: PAGE_FAIL on page %lusendpages: %lu, page lsn [%lu][%lu]sendpages: %lu, lsn [%lu][%lu]Update setup for %d files.Update setup: First LSN [%lu][%lu].Update setup: Last LSN [%lu][%lu]Update_setup: Error: Clear PAGE, set UPDATE again. %s__db.rep.init%sQAM: Unlink %s via __qam_removeqam_remove returned %drep_bulk_page: Processing LSN [%lu][%lu]rep_bulk_page: p %#lx ep %#lx pgrec data %#lx, size %lu (%#lx)rep_bulk_page: rep_page ret %dPAGE: Old page: msg LSN [%lu][%lu] first_lsn [%lu][%lu]PAGE: Received page %lu from file %dMsg file %d != curfile %dPAGE: Client_dbinit %sPAGE: Received duplicate page %lu from file %dPAGE: Write page %lu into mpoolpage_fail: BEFORE page %lu failed. ready %lu, max %lu, npages %dpage_fail: AFTER page %lu failed. ready %lu, max %lu, npages %drep_write_page: Calling fop_create for %swrite_page: Page %d needs to be swappedPAGE_GAP: pgno %lu < ready %lu, waiting %luPAGE_GAP: pgno %lu, max_pg %lu ready %lu, waiting %lu max_wait %luPAGE_GAP: Set cursor for ready %lu, waiting %luPAGE_GAP: Next cursor No next - ready %lu, waiting %luPAGE_GAP: Next cursor ready %lu, waiting %luclean up interrupted internal initFILEDONE: have %lu pages. Need %lu.NEXTFILE: have %d files. RECOVER_LOG nowNEXTFILE: LOG_REQ from LSN [%lu][%lu] to [%lu][%lu]NEXTINFO: Fileinfo read: %sNext file %d: pgsize %lu, maxpg %lurep_mpf_open: Different endian database. Set swap bit.Queue fileinfo: first %lu, last %lu, empty %dQueue fileinfo: First req: first %lu, last %luQueue fileinfo: Wrap req: first %lu, last %luCleaning up interrupted internal init__dbq.DB_ENV->rep_electDB_ENV->rep_elect: nsites must be zero if leases configuredDB_ENV->rep_elect:WARNING: nvotes (%d) is sub-majority with nsites (%d)DB_ENV->rep_elect: nvotes (%d) is larger than nsites (%d)Start election nsites %d, ack %d, priority %dSetting priority 0, unelectable, due to internal init/recoveryBeginning an electionEnded election phase 1Egen changed while waiting. Now %lu. New timeout %lu, orig timeout %luEgen changed from %lu to %luCounted my vote %dNo electable site found: recvd %d of %d votes from %d sitesNot enough votes to elect: recvd %d of %d from %d sitesSending voteSkipping phase2 wait: already got %d votesEnded election phase 2 %dWhile waiting egen changed to %lu. Phase 2 New timeout %lu, orig timeout %luEgen ph2 changed from %lu to %luAfter phase 2: votes %d, nvotes %d, nsites %dEnded election with %d, sites %d, egen %lu, flags 0x%lxMaster received voteReceived vote1 egen %lu, egen %luReceived old vote %lu, egen %lu, ignoring vote1Received VOTE1 from egen %lu, my egen %lu; resetGrow sites returned error %dIn phase 2, ignoring vote1Tally returned %d, sites %dELECTABLEIncoming vote: (eid)%d (pri)%lu %s (gen)%lu (egen)%lu [%lu,%lu]Existing vote: (eid)%d (pri)%lu (gen)%lu (sites)%d [%lu,%lu]Not in election, but received vote1 0x%xPhase1 election done(self)Voting for %d%sAfter phase 1 done: counted vote %d of %d (master)We received a vote%sNot in election gen %lu, at %lu, got voteBad vote egen %lu. Mine %luCounted vote %d of %dTally found[%d] (%d, %lu), this vote (%d, %lu)Tallying VOTE%c[%d] (%d, %lu)Accepting new voteGot enough votes to win; election done; winner is %d, gen %lulease_grant: grant msg time %lu %lulease_grant: eid %d, start %lu %lu, end %lu %lu, duration %lu %lulease_check: min_leases %lu curtime %lu %lulease_check: valid %lu eid %d, lease_lsn [%lu][%lu]lease_check: endtime %lu %luvalid %lu, min %luwait_time: grant_expire %lu %lu lease_to %luwait_time: mytime %lu %lu, grant_expire %lu %lu[%lu][%lu]: LOG_REQ max lsn: [%lu][%lu]Request for LSN [%lu][%lu] failsClient initialization failed. Need to manually restore clientUnable to get prev of [%lu][%lu]DB_ENV->rep_get_configDB_ENV->rep_set_configDB_ENV->rep_set_config: leases must be configured before DB_ENV->rep_startDB_ENV->rep_set_config: leases cannot be turned offDB_ENV->rep_startDB_ENV->rep_start: must specify DB_REP_CLIENT or DB_REP_MASTERDB_ENV->rep_set_transport must be called before DB_ENV->rep_startDB_ENV->rep_start: must call DB_ENV->rep_set_timeout for leases firstThread already in lockoutrep_start: Cannot become master without being elected when using leases.New master gen %lu, egen %lurep_start: Cannot become master with outstanding lease granted.rep_start: Old log version was %lurep_start: Found old version log %d__db.rep.db__db.reppg.dbrestore_prep: No prepares. Skip.First record not foundrestore_prep: Prepare resolved. SkipCheckpoint record at LSN [%lu][%lu] not foundInvalid checkpoint record at [%lu][%lu]Checkpoint LSN record [%lu][%lu] not foundAttempt to get first log record failedFinal log record not foundDB_ENV->rep_get_limitDB_ENV->rep_set_limitDB_ENV->rep_set_nsitesDB_ENV->rep_set_nsites: must be called before DB_ENV->rep_startDB_ENV->rep_set_timeout: lease timeout must be set before DB_ENV->rep_start.Unknown timeout type argument to DB_ENV->rep_set_timeoutunknown timeout type argument to DB_ENV->rep_get_timeoutDB_ENV->rep_get_requestDB_ENV->rep_set_requestDB_ENV->rep_set_request: Invalid min or max valuesDB_ENV->rep_set_transport: no send function specifiedDB_ENV->rep_set_transport: eid must be greater than or equal to 0DB_ENV->rep_set_clockskewDB_ENV->rep_set_clockskew: Zero only valid for when used for both argumentsDB_ENV->rep_set_clockskew: slow_clock value is larger than fast_clock_valueDB_ENV->rep_set_clockskew: must be called before DB_ENV->rep_startDB_ENV->rep_flushDB_ENV->rep_syncDB_ENV->rep_process_messageDB_ENV->rep_process_message: control argument must be specifiedEnvironment not configured as replication master or clientDB_ENV->rep_process_message: error retrieving DBT contentsrep_process_messageunsupported old replication message version %lu, minimum version %dReceived record %lu with old rep version %luConverted to record %lu with old rep version %luunexpected replication message version %lu, expected %dunsupported old replication log version %lu, minimum version %dReceived record %lu with old log version %luunexpected log record version %lu, expected %dRacing replication msg lockout, ignore message.Inconsistent lease configurationClient received lease message and not using leasesUpdating gen from %lu to %luReceived ALIVE egen of %lu, mine %luClient record received on masterMaster record received on clientNEWCLIENT is cleaning up old internal init for invalid masterNEWCLIENT error cleaning up internal init for invalid master: %dDelayed START_SYNC memp_sync due to missing records.ready LSN [%lu][%lu], ckp_lsn [%lu][%lu]DB_ENV->rep_process_message: unknown replication message: type %luALIVE: Completed sync [%lu][%lu]rep_apply: In election. Ignoring [%lu][%lu]rep_apply: Set apply_th %drep_apply: Decrement apply_th %dStarting delayed __memp_sync call [%lu][%lu]Start-up is done [%lu][%lu]Returning ISPERM [%lu][%lu], cmp = %dReturning LOGREADY up to [%lu][%lu], cmp = %dReturning NOTPERM [%lu][%lu], cmp = %dReturning %d [%lu][%lu], cmp = %dfailed to read the log at [%lu][%lu]transaction failed at [%lu][%lu]collect failed at: [%lu][%lu]rep_newfile: Old-style NEWFILE msg. Use control msg log version: %lurep_newfile: File %lu vers %luError syncing ckp [%lu][%lu]Error processing txn [%lu][%lu]process_rec: prepare at [%lu][%lu]__db.rep.egenRead in egen %lu%s__db.rep.genRead in gen %luDB_ENV->rep_statDB_ENV->rep_stat_printDefault replication region information:Environment configured as a replication masterEnvironment configured as a replication clientEnvironment not configured for replicationNext LSN expectedNext LSN to be used%lu/%lu %sNot waiting for any missed log recordsLSN of first log record we have after missed log recordsNo maximum permanent LSNMaximum permanent LSNNext page number expectedNot waiting for any missed pagesPage number of first page we have after missed pages%lu %sNumber of duplicate master conditions originally detected at this siteCurrent environment IDNo current environment IDCurrent environment priorityCurrent generation numberCurrent election generation numberNumber of duplicate log records receivedNumber of log records currently queuedMaximum number of log records ever queued at onceTotal number of log records queuedNumber of log records received and appended to the logNumber of log records missed and requestedCurrent master IDNo current master IDNumber of times the master has changedNumber of messages received with a bad generation numberNumber of messages received and processedNumber of messages ignored due to pending recoveryNumber of failed message sendsNumber of messages sentNumber of new site messages receivedNumber of environments believed to be in the replication groupTransmission limitedNumber of outdated conditions detectedNumber of duplicate page records receivedNumber of page records received and added to databasesNumber of page records missed and requestedStartup incompleteStartup completeNumber of transactions appliedNumber of startsync messages delayedNumber of elections heldNumber of elections wonNo election in progress%lu.%.6lu Duration of last election (seconds)Current election phaseElection winnerElection generation number%lu/%lu Maximum LSN of election winnerNumber of sites expected to participate in electionsNumber of votes needed to win an electionElection priorityElection tiebreaker valueVotes received this election roundNumber of bulk buffer sends triggered by full bufferNumber of single records exceeding bulk buffer sizeNumber of records added to a bulk bufferNumber of bulk buffers sentNumber of re-request messages receivedNumber of request messages this client failed to processNumber of request messages received by this client%lu.%.6lu Duration of maximum lease (seconds)%sDB_REP handle information:! %sSet %sBookkeeping database FlagsREP handle information:Replication region mutexBookkeeping database mutex%ld %sEnvironment IDMaster environment IDElection generationLast generation number in logSpace allocated for sitesSites in groupVotes needed for electionPriority in electionLimit on data sent in a single callRequest gap secondsRequest gap microsecondsMaximum gap secondsMaximum gap microsecondsCallers in rep_proc_msgLibrary handle countMulti-step operation count0%.24s Recovery timestampSites heard fromCurrent winnerWinner priorityWinner generationWinner LSNWinner tiebreakerVotes for this siteLOG replication information:First log record after a gapMaximum permanent LSN processedLSN waiting to verifyMaximum LSN requestedTime to wait before requesting secondsTime to wait before requesting microsecondsMaximum lease timestamp secondsMaximum lease timestamp microsecondsDBREP_OPENFILESREP_F_CLIENTREP_F_EPHASE1REP_F_EPHASE2REP_F_INREPELECTREP_F_MASTERREP_F_MASTERELECTREP_F_NOARCHIVEREP_F_READY_APIREP_F_READY_MSGREP_F_READY_OPREP_F_RECOVER_LOGREP_F_RECOVER_PAGEREP_F_RECOVER_UPDATEREP_F_RECOVER_VERIFYREP_F_TALLYbulk_msg: Record %d (0x%x) larger than entire buffer 0x%xbulk_msg: Record %lu (%#lx) doesn't fit. Send %lu (%#lx) now.bulk_msg: Record %lu (0x%lx) hit throttle limit.bulk_msg: Send buffer after copy due to PERMsend_bulk: Send %d (0x%x) bulk buffer bytesrep_send_msg: rtype %lu to version %lu record %lu.rep_send_message: Unknown rep version %lu, my version %lurep_send_messagerep_send_function returned: %dUpdating gen from %lu to %lu from master %degen: %lu. rep version %luresend_req ret is %luNo commit or ckp found. Truncate log.Election finished in %lu.%09lu secElection done; egen %luOperation locked out. Waiting for replication lockout to completeDB_ENV handle waiting %d minutes for replication lockout to complete%s %sreplication recovery unrolled committed transactions;open DB and DBcursor handles must be closed__op_rep_enter waiting %d minutes for lockout to completeop_cnthandle_cntapply_thmsg_thCLIENTMASTERREP_UNDEF%s: %salivealive_reqall_reqbulk_logbulk_pagedupmasterfilefile_failfile_reqlease_grantloglog_morelog_reqmaster_reqnewclientnewfilenewmasternewsitepagepage_failpage_morepage_reqrerequeststart_syncupdateupdate_reqverifyverify_failverify_reqvote1vote2NOTYPE any flush nogroup lease nobuf perm rereq resend logend%s %s: msgv = %lu logv %lu gen = %lu eid %d, type %s, LSN [%lu][%lu] %s    VERIFY_FAIL is cleaning up old internal init for missing logVERIFY_FAIL error cleaning up internal init for missing log: %dSkip sync-up rec. Truncate log to [%lu][%lu], ckp [%lu][%lu]library build did not include support for the Replication ManagerPage %lu: overflow page has zero reference countPage %lu: overflow page of invalid type %luPage %lu: first page in overflow chain has a prev_pgno %luPage %lu: encountered too many times in overflow traversalPage %lu: overflow page linked twice from leaf or data pagePage %lu: bad next_pgno %lu on overflow pagePage %lu: bad prev_pgno %lu on overflow page (should be %lu)Page %lu: overflow item incompleteDB->verifyDB_SALVAGE requires a an output handleDB_ORDERCHKONLY requires a database name%sMetadata page %lu cannot be readPage %lu: Incomplete metadata pagePage %lu: metadata page corruptedPage %lu: could not check metadata pagePage %lu: pgno incorrectly set to %luPage %lu: bad magic number %luPage %lu: unsupported DB version %lu; extraneous errors may resultPage %lu: bad page size %luPage %lu: bad page type %luPage %lu: bad meta-data flags value %#lxPage %lu: old-style duplicate pagePage %lu: unknown page type %lu__db_vrfy_structurePage %lu: overflow refcount %lu, referenced %lu timesPage %lu: unreferenced pagePage %lu: totally zeroed pagePage %lu: bad page number %luPage %lu: invalid next_pgno %luPage %lu: invalid prev_pgno %luPage %lu: too many entries: %luPage %lu: bad btree level %luPage %lu: btree leaf page has incorrect level %luPage %lu: nonzero level %lu in non-btree database__db_vrfy_metaPage %lu: invalid magic numberPage %lu: magic number does not match database typePage %lu: unsupported database version %lu; extraneous errors may resultPage %lu: invalid pagesize %luPage %lu: nonempty free list on subdatabase metadata pagePage %lu: nonsensical free list pgno %luPage %lu: last_pgno is not correct: %lu != %luPage %lu: invalid next_pgno %lu on free list pagePage %lu: page %lu encountered a second time on free listPage %lu: non-invalid page %lu on free listSubdatabase entry not page-number sizeSubdatabase entry references invalid page %luSubdatabase entry references page %lu of invalid type %luSubdatabase entry of invalid sizePage %lu: DB->h_internal field is NULL%$sniglet^&Page %lu: incorrect hash function for databasePage %lu: database metapage of bad type %luUNKNOWN Page %lu: entries listing %lu overlaps dataPage %lu: bad offset %lu at page index %luPage %lu: unaligned offset %lu at page index %luPage %lu: item %lu of unrecognizable typePage %lu: item %lu extends past page boundaryPage %lu: sorted duplicate set in unsorted-dup databasePage %lu: unsorted duplicate set in sorted-dup databasePage %lu: %s is of inappropriate type %luduplicate pagePage %lu: duplicate page of inappropriate type %lu__OTHER__Page %lu: nonsensical bt_minkey value %lu on metadata pagePage %lu: nonsensical root page %lu on metadata pagePage %lu: Btree metadata page has both duplicates and multiple databasesPage %lu: Btree metadata page illegally has both recnums and dupsPage %lu: metadata page has renumber flag set but is not recnoPage %lu: recno metadata page specifies duplicatesPage %lu: re_len of %lu in non-fixed-length database__ram_vrfy_leafPage %lu: Recno database has dupsPage %lu: nonsensical type for item %lu__bam_vrfyPage %lu: item order check unsafe: skipping__ram_vrfy_inpPage %lu: entries listing %lu overlaps dataPage %lu: bad offset %lu at index %luPage %lu: RINTERNAL structure at offset %lu referenced twicePage %lu: gap between items at offset %luPage %lu: bad HOFFSET %lu, appears to be %lu__bam_vrfy_inpPage %lu: duplicated item %luPage %lu: item %lu marked deletedPage %lu: duplicate page referenced by internal btree page at item %luPage %lu: duplicate page referenced by recno page at item %luPage %lu: impossible tlen %lu, item %luPage %lu: offpage item %lu has bad pgno %luPage %lu: item %lu of invalid type %luPage %lu: offset %lu unalignedPage %lu: overlapping items at offset %lu__bam_vrfy_itemorderPage %lu: error %lu in fetching overflow item %luPage %lu: out-of-order key at entry %luPage %lu: non-dup dup key at entry %luPage %lu: database with no duplicates has duplicated keysPage %lu: btree metadata page observed twicePage %lu: btree metadata page has no rootPage %lu: recno database has bad re_len %luPage %lu: duplicate tree referenced from metadata pagePage %lu: btree root of incorrect type %lu on metadata pagePage %lu: unexpected page type %lu found in leaf chain (expected %lu)Page %lu: incorrect next_pgno %lu found in leaf chain (should be %lu)Page %lu: incorrect prev_pgno %lu found in leaf chain (should be %lu)Page %lu: recno leaf page non-recno treePage %lu: non-recno leaf page in recno treePage %lu: duplicates in non-dup btreePage %lu: unsorted duplicate set in sorted-dup databasePage %lu: %s is of inappropriate type %lubtree or recno pagePage %lu: totally zeroed pagePage %lu: btree or recno page is of inappropriate type %lu__bam_vrfy_subtreePage %lu: recno page returned bad re_len %luPage %lu: record count incorrect: actual %lu, in record %luPage %lu: recno level incorrect: got %lu, expected %luPage %lu: overflow page %lu referenced more than twice from internal pagePage %lu: item %lu has incorrect record count of %lu, should be %luPage %lu: Btree level incorrect: got %lu, expected %luPage %lu: internal page is empty and should not bePage %lu: bad record count: has %lu records, claims %luPage %lu: linked twicePage %lu: unterminated leaf chain__bam_vrfy_treeorderPage %lu: first item on page sorted greater than parent entryPage %lu: first item on page had comparison errorPage %lu: last item on page sorted greater than parent entryPage %lu: last item on page had comparison errorUNKNOWN_KEYUNKNOWN_DATA __bam_salvage__bam_salvage_walkdupint%s: Lock is no longer validLocker is not validDB_ENV->lock_vecInvalid lock operation: %dDB_ENV->lock_getlock entriesLocker does not existDB_ENV->lock_get: invalid lock mode %luUnexpected lock status: %dDB_LOCK->lock_putlock_downgradeobject entriesNo space for lock object storageNot a child transactionDB_ENV->lock_detectDB_ENV->lock_detect: unknown deadlock detection mode specifiedwarning: unable to abort locker %lxAborting locker %lx%lu lockerslocker has write locksFreeing read locks for locker %#lx: %sDB_ENV->lock_idDB_ENV->lock_id_freeUnknown locker id: %lxLocker still has lockslock_id_setlocker entriesFreeing locker with locks(%lx %lx %lx %lx %lx)%14s.%-10s%-25s %dDB_ENV->get_lk_conflictsDB_ENV->set_lk_conflictsDB_ENV->get_lk_detectDB_ENV->set_lk_detectDB_ENV->set_lk_detect: unknown deadlock detection mode specifiedDB_ENV->set_lk_detect: incompatible deadlock detector modeDB_ENV->get_lk_maxlocksDB_ENV->set_lk_max_locksDB_ENV->get_lk_max_lockersDB_ENV->set_lk_max_lockersDB_ENV->get_lk_max_objectsDB_ENV->set_lk_max_objectsDB_ENV->get_lk_partitionsDB_ENV->set_lk_partitionsDB_ENV->get_env_timeoutDB_ENV->get_timeoutDB_ENV->set_env_timeoutDB_ENV->set_timeoutlock_open: incompatible deadlock detector modeunable to allocate memory for the lock tableDB_ENV->lock_statDB_ENV->lock_stat_printDefault locking region information:Last allocated locker ID%#lx Current maximum unused locker IDNumber of lock modesMaximum number of locks possibleMaximum number of lockers possibleMaximum number of lock objects possibleNumber of lock object partitionsNumber of current locksMaximum number of locks at any one timeMaximum number of locks in any one bucketMaximum number of locks stolen by for an empty partitionMaximum number of locks stolen for any one partitionNumber of current lockersMaximum number of lockers at any one timeNumber of current lock objectsMaximum number of lock objects at any one timeMaximum number of lock objects in any one bucketMaximum number of objects stolen by for an empty partitionMaximum number of objects stolen for any one partitionTotal number of locks requestedTotal number of locks releasedTotal number of locks upgradedTotal number of locks downgradedLock requests not available due to conflicts, for which we waitedLock requests not available due to conflicts, for which we did not waitNumber of deadlocksLock timeout valueNumber of locks that have timed outTransaction timeout valueNumber of transactions that have timed outThe size of the lock regionThe number of partition locks that required waitingThe maximum number of times any partition lock was waited forThe number of object queue operations that required waitingThe number of locker allocations that required waitingThe number of region locks that required waitingMaximum hash bucket lengthLock%sLock region parameters:Lock region region mutex%lu %slocker table sizeobject table sizeobj_offlocker_offneed_dd%m-%d-%H:%M:%Snext_timeout: %s.%09lunext_timeout: %lu.%09luLock conflict matrix:%lu Locks grouped by lockers:Locks grouped by object:%8lx dd=%2ld locks held %-4d write locks %-4d pid/thread %sexpires %s.%09luexpires %lu.%09lu lk timeout %lu lk expires %s.%09lu lk expires %lu.%09lu%-8s %-10s%-4s %-7s %sLockerModeCountStatus----------------- Object ---------------IREADIWRIWRITENGREADREAD_UNCOMMITTEDWRITEWAS_WRITEWAITUNKNOWNABORTEXPIREDFREEHELDPENDING%8lx %-10s %4lu %-7s (%lx %lx %lx %lx %lx) %14s:%-10s%-25s recordhandlepage%-7s %7lu0x%lx Lock table is out of available %sunable to allocate memory for mutex; resize mutex regionFreeing mutex for process: %sDB_ENV->mutex_allocDB_ENV->set_mutex_alignDB_ENV->mutex_set_align: alignment value must be a non-zero power-of-twoDB_ENV->set_mutex_incrementDB_ENV->set_mutex_maxUnable to acquire/release a mutex; check configurationUnable to allocate memory for the mutex regionUnable to allocate memory for mutexes from the regionDB_ENV->mutex_statDB_ENV->mutex_stat_printMutex counts%d Unallocated%lu %sDefault mutex region information:Mutex region sizeThe number of region locks that required waitingMutex alignmentMutex test-and-set spinsMutex total countMutex free countMutex in-use countMutex maximum in-use countMutex%sDB_MUTEXREGION structure:DB_MUTEXREGION region mutexSize of the aligned mutexNext free mutexmutex wait/nowait, pct wait, holder, flags%5lu , %s ()%lu %s [!Set][%lu%luM/%lu/%luM %d%% %s] !Own]application allocateddb handleenv dblistenv handleenv regionlock regionlogical locklog filenamelog flushlog handlelog regionmpoolfile handlempool filehandlempool file bucketmpool handlempool hash bucketmpool buffer I/Ompool regionmutex regionmutex testreplication checkpointreplication databasereplication eventreplication regionsequencetwistertxn active listtransaction checkpointtxn committxn mvcctxn regionunknown mutex typealloclockedlogicalprocess-privateself-blockEncrypted environment: library build did not include cryptography supportrename: database %s existsDB->openClosing a primary DB while a secondary DB has active cursors is unsafe%s%x.%x__db.%.*s%x.%x%s%s%.*s%s%sDB->cursorDB->put%s%sAppend results in a non-unique secondary key in an index not configured to support duplicatesunsupported byte order, only big and little-endian supported__dbc_count__dbc_idup__dbc_get%s%sPut results in a non-unique secondary key in an index not configured to support duplicatesDuplicate data items are not supported with sorted dataWrite attempted on read-only cursorAttempt to execute cascading delete in a foreign index failedForeign database application callbackAttempt to overwrite item in foreign database with nullified value failedCDS groups do not support %sabortCDS group has active cursorsdiscardprepareset_nameset_timeoutcdsgroup_beginchecksum error: page %lu: catastrophic recovery required__db_dispatchIllegal application-specific record type %lu in logIllegal record type %lu in logAttempting to add application-specific record with invalid type %luAttempting to add internal record with invalid type %luMaxid: %lu Generation: %lu Unrecognized type: %d OKcommitprepareabortignoreexpectedunexpectedUNKNOWNTXNID: %lx(%lu): %s combination illegal flag %sspecified to %s%s: DB_READ_COMMITTED, DB_READ_UNCOMMITTED and DB_RMW require lockingunable to create/retrieve page %lupage %lu: illegal page type or formatPANIC: fatal region error detected; run recoveryPANICSuccessful return: 0DB_BUFFER_SMALL: User memory too small for return valueDB_DONOTINDEX: Secondary index callback returns nullDB_FOREIGN_CONFLICT: A foreign database constraint has been violatedDB_KEYEMPTY: Non-existent key/data pairDB_KEYEXIST: Key/data pair already existsDB_LOCK_DEADLOCK: Locker killed to resolve a deadlockDB_LOCK_NOTGRANTED: Lock not grantedDB_LOG_BUFFER_FULL: In-memory log buffer is fullDB_NOSERVER: Fatal error, no RPC serverDB_NOSERVER_HOME: Home unrecognized at serverDB_NOSERVER_ID: Identifier unrecognized at serverDB_NOTFOUND: No matching key/data pair foundDB_OLDVERSION: Database requires a version upgradeDB_PAGE_NOTFOUND: Requested page not foundDB_REP_DUPMASTER: A second master site appearedDB_REP_HANDLE_DEAD: Handle is no longer validDB_REP_HOLDELECTION: Need to hold an electionDB_REP_IGNORE: Replication record ignoredDB_REP_ISPERM: Permanent record writtenDB_REP_JOIN_FAILURE: Unable to join replication groupDB_REP_LEASE_EXPIRED: Replication leases have expiredDB_REP_LOCKOUT: Waiting for replication recovery to completeDB_REP_NEWSITE: A new site has entered the systemDB_REP_NOTPERM: Permanent log record not writtenDB_REP_UNAVAIL: Unable to elect a masterDB_RUNRECOVERY: Fatal error, run database recoveryDB_SECONDARY_BAD: Secondary index inconsistent with primaryDB_VERIFY_BAD: Database verification failedDB_VERSION_MISMATCH: Database environment version mismatchUnknown error: %d: %s: %s%s%s: Unknown flag: %#x%s: Unexpected database type: %s%s: Unexpected code path errorTransaction not specified for a transactional databaseCDS groups can only be used in a CDS environmentTransaction specified for a non-transactional databaseOperation forbidden while secondary index is being createdTransaction and database from different environmentsTransaction that opened the DB handle is still active%s%sprevious transaction deadlock return not resolvedDB environment not configured for transactions%lu larger than database's maximum record length %lu%s: replacement length %lu differs from replaced length %luRecord length errorLog sequence error: page LSN %lu %lu; previous LSN %lu %lu%s: attempt to modify a read-only database%s: file limited to %lu pagesThread/process %s failed: %s%s: %s: %s %s%s: %s: Invalid numeric argument %s: Invalid numeric argument%s: %s: Less than minimum value (%ld) %s: Less than minimum value (%ld)%s: %s: Greater than maximum value (%ld) %s: Greater than maximum value (%ld)%s: %s: Less than minimum value (%lu) %s: Less than minimum value (%lu)%s: %s: Greater than maximum value (%lu) %s: Greater than maximum value (%lu)Databases may not become secondary indices while cursors are openSecondary index handles may not be re-associatedSecondary indices may not be used as primary databasesPrimary databases may not be configured with duplicatesRenumbering recno databases may not be used as primary databasesThe primary and secondary must be opened in the same environmentThe DB_THREAD setting must be the same for primary and secondaryCallback function may be NULL only when database handles are read-onlyDB->associateDB->closeDB->cursor%s %sreplication recovery unrolled committed transactions;open DB and DBcursor handles must be closedDB->delDB->existsDB->fdDatabase does not have a valid file handleDB->getDB_READ_UNCOMMITTEDDB_READ_COMMITTED%s is not supported with DB_CONSUME or DB_CONSUME_WAITkeydataDB_MULTIPLE requires DB_DBT_USERMEM be setDB_MULTIPLE does not support DB_DBT_PARTIAL%s%sDB_MULTIPLE buffers must be aligned, at least page size and multiples of 1KBDB->joinAt least one secondary cursor must be specified to DB->joinAll secondary cursors must share the same transactionDB->key_rangefiles containing multiple databases may only be opened read-onlyDB->openDB_UNKNOWN type specified with DB_CREATE or DB_TRUNCATEunknown type: %ludatabase environment not yet openedenvironment did not include a memory poolenvironment not created using DB_THREADDB_MULTIVERSION illegal without a transaction specifiedDB_MULTIVERSION illegal with queue databaseslockingtransactionsDB_TRUNCATE illegal with %s specifiedQueue databases must be one-per-fileDB->pgetDB->pget may only be used on secondary indicesDB_MULTIPLE and DB_MULTIPLE_KEY may not be used on secondary indicesprimary keyDB_GET_BOTH on a secondary index requires a primary keyDB->putDB->put forbidden on secondary indiceskey DBTa partial put in the presence of duplicates requires a cursor operationDB->compactSecondary indices may not be used as foreign databasesForeign databases may not be configured with duplicatesRenumbering recno databases may not be used as foreign databasesThe associating database must be a secondary index.When specifying a delete action of nullify, a callback function needs to be configuredWhen not specifying a delete action of nullify, a callback function cannot be configuredDB->syncClosing already-closed cursorDBcursor->countDBcursor->delDBcursor->dupDBcursor->getDB_READ_UNCOMMITTED is not supported with DB_CONSUME or DB_CONSUME_WAITDB_MULTIPLE/DB_MULTIPLE_KEY require DB_DBT_USERMEM be setDB_MULTIPLE/DB_MULTIPLE_KEY do not support DB_DBT_PARTIALDB_MULTIPLE/DB_MULTIPLE_KEY buffers must be DBcursor->pget may only be used on secondary indicesDBcursor->pgetDB_GET_BOTHDB_GET_BOTH_RANGE%s requires both a secondary and a primary keyDBcursor->putDBcursor->put forbidden on secondary indicesDB_THREAD mandates memory allocation flag on %s DBTCursor position must be set before performing this operationDB_AUTO_COMMIT may not be specified along with a transaction handleDB_AUTO_COMMIT may not be specified in non-transactional environmentDBC->getDB_DBT_PARTIAL may not be set on key during join_getAllocation failed for join key, len = %luunnamed/%s%s%s%s page %lu is on free list with type %luXA applications may not specify an environment to db_createdb_createcall implies an access method which is inconsistent with previous callsDB->get_byteswappedDB->get_dbnameDB->get_multipleDB->get_typeDB->set_append_recnoDB->get_cachesizeDB->set_cachesizeDB->dup_compareDB->get_encrypt_flagsDB->set_encryptDatabase environment not configured for encryptionDB_NOT_DURABLEDB->set_flagsDB->set_lorderDB->set_allocDB->set_pagesizepage sizes may not be smaller than %lupage sizes may not be larger than %lupage sizes must be a power-of-2 @DB_CREATE must be specified to create databases.DBTYPE of unknown without existing file__db_dbopenDB->get_open_flags%s: Invalid type %d specifiedInvalid subdatabase type %d specified%s: metadata page checksum error%s: unexpected file type or formatw%schecksummingcreated by compensating transactiondatabase createdencompassing file createddbm/ndbm errorvariable lengthdiscard cached pagesduplicatessorted duplicatesencryptedfixed-length recordsin-memoryfile is being renamedchanges not loggedopen calledpad valuedefault page sizeread-onlyread-uncommittedBtree record numbersopened for recoveryrenumberno reverse splitssecondaryload on opensubdatabasesneedswaptransactionalverifierIn-memory DB structure:%s: %#lx ()bt_meta: %lu bt_root: %lubt_minkey: %lubt_compare: %#lx bt_prefix: %#lxbt_lpgno: %lure_pad: %#lx re_delim: %#lx re_len: %lu re_source: %sre_modified: %d re_eof: %d re_last: %lumeta_pgno: %luh_ffactor: %luh_nelem: %luh_hash: %#lxq_meta: %luq_root: %lure_pad: %#lx re_len: %lurec_page: %lupage_ext: %lu magic: %#lx version: %lu pagesize: %lu type: %lu keys: %lu records: %lu free list: %lu, Unable to retrieve free-list page: %lu: %s%s%lu last_pgno: %lu flags: %#lx uid: %x minkey: %lu re_len: %#lx re_pad: %#lx root: %lu max_bucket: %lu high_mask: %#lx low_mask: %#lx ffactor: %lu nelem: %lu h_charkey: %#lx spare points: %lu first_recno: %lu cur_recno: %lu re_len: %#lx re_pad: %lu rec_page: %lu page_ext: %luILLEGAL PAGE TYPE: page: %lu type: %lupage %lu: %s: LSN [%lu][%lu]: level %lu records: %lu D[%03lu] %4lu %sprev: %4lu next: %4lu%sref cnt: %4lu %sentries: %4lu offset: %4luILLEGAL PAGE OFFSET: indx: %lu of %lu%4lu [offpage dups]Duplicates: overflow: total len: %4lu page: %4luILLEGAL HASH PAGE TYPE: %lucount: %4lu pgno: %4lu type: %lu ILLEGAL BINTERNAL TYPE: %luentries %4lu pgno %4luILLEGAL DUPLICATE/LBTREE/LRECNO TYPE: %luILLEGAL PAGE TYPE: %lulen: %3lu data: %c%#.2x...duplicate: page: %4lu%s%sNot grantedShared/readExclusive/writeWait for eventIntent exclusive/writeIntent shared/readIntent to read/writeRead uncommittedWas writtenUNKNOWN LOCK MODEbtree metadataduplicatehash unsortedhashhash metadatabtree internalinvalidrecno internalbtree leafrecno leafoverflowqueue metadataqueueDB->dump%lu\\%c%c%c%c VERSION=3 format=print format=bytevalue database=type=btree DB->get_flagsrecnum=1 DB->get_bt_minkeybt_minkey=%lu type=hash DB->get_h_ffactorh_ffactor=%lu DB->get_h_nelemh_nelem=%lu type=queue DB->get_re_lenre_len=%lu DB->get_re_padre_pad=%#x DB->get_q_extentsizeextentsize=%lu type=recno renumber=1 __db_prheaderchksum=1 duplicates=1 dupsort=1 db_pagesize=%lu keys=1 HEADER=END DATA=END btreerecnoUNKNOWN TYPE0123456789abcdefmultiple-databasesbtree:recnumrecno:fixed-lengthrecno:renumberChecksum failure requires catastrophic recoveryCannot replicate prepared transactions from master running release 4.2 DB_ENV->dbremoveDB->removeRemove on temporary files invalid__db_subdb_removeDB_ENV->dbrenameDB->renameRename on temporary files invalidDB_ENV->fileid_reset%s%s: unexpected file type or formatDB_ENV->lsn_reset%sDB->statDB->stat_print%.24s Local time%sDB handle information:%lu %sPage size! %sSet %sAppend recnoFeedbackDup compareApp privateDbEnv!Set%s %sTypeThread mutexFileDatabase%#lx %sOpen flags File IDCursor adjust IDMeta pgnoLocker IDHandle lockAssociate lockRPC remote ID0%.24s Replication handle timestampSecondary callbackPrimary handleapi internalBtree/Recno internalHash internalQueue internalXA internal FlagsFile naming informationDB handle cursors:Active queue:Join queue:Free queue:DBCAssociated dbpAssociated txnInternalDefault locker IDLockerOff-page duplicate cursorReferenced pageRootPage numberPage indexLock modeDBC_ACTIVEDBC_DONTLOCKDBC_MULTIPLEDBC_MULTIPLE_KEYDBC_OPDDBC_OWN_LIDDBC_READ_COMMITTEDDBC_READ_UNCOMMITTEDDBC_RECOVERDBC_RMWDBC_TRANSIENTDBC_WRITECURSORDBC_WRITERDB_AM_CHKSUMDB_AM_COMPENSATEDB_AM_CREATEDDB_AM_CREATED_MSTRDB_AM_DBM_ERRORDB_AM_DELIMITERDB_AM_DISCARDDB_AM_DUPDB_AM_DUPSORTDB_AM_ENCRYPTDB_AM_FIXEDLENDB_AM_INMEMDB_AM_IN_RENAMEDB_AM_NOT_DURABLEDB_AM_OPEN_CALLEDDB_AM_PADDB_AM_PGDEFDB_AM_RDONLYDB_AM_READ_UNCOMMITTEDDB_AM_RECNUMDB_AM_RECOVERDB_AM_RENUMBERDB_AM_REVSPLITOFFDB_AM_SECONDARYDB_AM_SNAPSHOTDB_AM_SUBDBDB_AM_SWAPDB_AM_TXNDB_AM_VERIFYINGDB->truncate forbidden on secondary indicesDB->truncateDB->truncate not permitted with active cursorsDB->upgrade%s%s: unsupported btree version: %luAttempt to upgrade an encrypted database without providing a password.%s: unsupported hash version: %lu%s: unsupported queue version: %lu%s: DB->upgrade only supported on native byte-order systems%s: unrecognized file type%s: file size not a multiple of the pagesizedbm: no open database. .dbLogging region out of memory; you may need to increase its sizeFreeing log information for process: %s, (ref %lu)__dbreg_register_recoverWarning: Improper file close at %lu/%lu%sDB handle FNAME contents:%ld %slog ID%lu %sMeta pgno File IDcreate txn FlagsLOG FNAME list:File name mutexFid maxID Name Type Pgno Pid Txnid Flags DBP-info:No DBPDBP%ld %-8s%s%-8s%s %lu %lu %lx %lx %s (%d %lx %lx)DB_FNAME_DURABLEDB_FNAME_NOTLOGGEDRegion allocations: %lu allocations, %lu failures, %lu frees, %lu longest%sAllocations by power-of-two sizes:%3dKB %luDB_CONFIGrDB_CONFIG: line %d: illegal inputline %d: %s: incorrect name-value pairmutex_set_alignmutex_set_incrementmutex_set_maxmutex_set_tas_spinsrep_set_clockskewrep_set_configdb_rep_conf_bulkdb_rep_conf_delayclientdb_rep_conf_leasedb_rep_conf_noautoinitdb_rep_conf_nowaitdb_repmgr_conf_2site_strictrep_set_limitrep_set_nsitesrep_set_priorityrep_set_requestrep_set_timeoutdb_rep_ack_timeoutdb_rep_checkpoint_delaydb_rep_connection_retrydb_rep_election_timeoutdb_rep_election_retrydb_rep_full_election_timeoutdb_rep_heartbeat_monitordb_rep_heartbeat_senddb_rep_lease_timeoutrepmgr_set_ack_policydb_repmgr_acks_alldb_repmgr_acks_all_peersdb_repmgr_acks_nonedb_repmgr_acks_onedb_repmgr_acks_one_peerdb_repmgr_acks_quorumset_cachesizeset_data_dirdb_data_dirset_intermediate_dirset_intermediate_dir_modeset_flagsdb_auto_commitdb_cdb_alldbdb_direct_dbdb_dsync_dbdb_multiversiondb_nolockingdb_nommapdb_nopanicdb_overwritedb_region_initdb_txn_nosyncdb_txn_nowaitdb_txn_snapshotdb_txn_write_nosyncdb_yieldcpudb_log_inmemorydb_direct_logdb_dsync_logdb_log_autoremoveset_log_configdb_log_auto_removedb_log_directdb_log_dsyncdb_log_in_memorydb_log_zeroset_lg_bsizeset_lg_filemodeset_lg_maxset_lg_regionmaxset_lg_dirdb_log_dirset_lk_detectdb_lock_defaultdb_lock_expiredb_lock_maxlocksdb_lock_maxwritedb_lock_minlocksdb_lock_minwritedb_lock_oldestdb_lock_randomdb_lock_youngestset_lk_max_locksset_lk_max_lockersset_lk_max_objectsset_lk_partitionsset_lock_timeoutset_mp_max_openfdset_mp_max_writeset_mp_mmapsizeset_region_initset_shm_keyset_tas_spinsset_tmp_dirdb_tmp_dirset_tx_maxset_txn_timeoutset_verbosedb_verb_deadlockdb_verb_fileopsdb_verb_fileops_alldb_verb_recoverydb_verb_registerdb_verb_replicationdb_verb_rep_electdb_verb_rep_leasedb_verb_rep_miscdb_verb_rep_msgsdb_verb_rep_syncdb_verb_repmgr_connfaildb_verb_repmgr_miscdb_verb_waitsforunrecognized name-value pair: %s DB_ENV->failchkDB_ENV->failchk requires DB_ENV->is_alive be configuredis_alive method specified but no thread region allocatedthread table must be allocated when the database environment is createdunable to allocate a thread status blockThread died in Berkeley DB library%s/%s%llu%s=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=DB_ENV->get_homeDB_ENV->set_allocDB_ENV->set_app_dispatchlibrary build did not include support for cryptography@ @@ @ DB_ENV->set_flagsDB_ENV->set_flags: direct I/O either not configured or not supportedDB_ENV->set_flags: DB_CDB_ALLDBDB_ENV->set_flags: DB_PANIC_ENVIRONMENTEnvironment panic setDB_ENV->set_flags: DB_REGION_INITDB_ENV->set_intermediate_dir_modeDB_ENV->set_intermediate_dir_mode: illegal mode "%s"is_alive method specified but no thread region allocatedDB_ENV->set_thread_countDB_ENV->set_shm_key%s: method not permitted when environment specifiedafterbefore%s: method not permitted %s handle's open methodlockingloggingmemory poolreplicationtransaction%s interface requires an environment configured for the %s subsystemBerkeley DB was not configured for RPC support/%sBDBXXXXXtemporary open: %sBerkeley DB 4.7.25: (May 15, 2008)DB_ENV->openBerkeley DB library does not support DB_REGISTER on this systemregistration requires transaction supportBerkeley DB library does not support replication on this systemreplication requires locking supportreplication requires transaction supportrecovery requires the create flagrecovery requires transaction supportarchitecture lacks fast mutexes: applications cannot be threadedThe DB_RECOVER flag was not specified, and recovery is neededDB_ENV->removeDB_HOMEDB_ENV->closeDatabase handles still open at environment closeunnamed/Open database handle: %s%s%sFile handles still open at environment closeOpen file handle: %sDB_ENV->get_open_flagsCopyright (c) 1996,2008 Oracle. All rights reserved. initialInvalid recovery timestamp %s; earliest time is %sLast log record not foundFirst log record not foundInvalid checkpoint record at [%ld][%ld]Checkpoint LSN record [%ld][%ld] not foundRecovery starting from [%lu][%lu]backwardforwardRecovery complete at %.24s%s %lx %s [%lu][%lu]Maximum transaction IDRecovery checkpointRecovery function for LSN %lu %lu failed on %s passRecovery function for LSN %lu %lu failedLog file corrupt at LSN: [%lu][%lu]Unknown version %luprocess-private%s__db.001%s: unable to read system-memory information%s: existing environment not created in system memoryProgram version %d.%d doesn't match environment version %d.%dBuild signature doesn't match environmentconfigured environment flags incompatible with existing environmentunable to create new master region array%s: unable to find environment%s: unable to write out public environment IDunable to join the environmentenvironment reference count went negative.__db__dbq.__db.register__db.rep__db.%03dno room remaining for additional REGIONs%lu: register environment__db.register%lu: creating %s%24lu %lu: adding self to registryX 0 %02u: EMPTYDB_REGISTER limits processes to one open DB_ENV handle per environment%02u: %s: FAILED%02u: %s: LOCKED%lu: recovery required%lu: locking slot %02u at offset %lu%lu: recovery completed, unlocking%s: exclusive file unlockDB_ENV->stat_print%.24s Local time%sDefault database environment information:%#lx %sMagic number%ld %sPanic value%d.%d.%d Environment versionBtree versionHash versionLock versionLog versionQueue versionSequence versionTxn version%.24s Creation timeEnvironment IDPrimary region allocation and reference count mutexReferencesENVDB_ENV handle mutex! %sSet %sErrcallErrfile!Set%s %sErrpfxMsgfileMsgcallAppDispatchEventFeedbackFreePanicMallocReallocIsAliveThreadIdThreadIdStringLog dirTmp dirData dir%s Data dirIntermediate directory modeShared memory keyPasswordRPC client%lu %sRPC client IDApp privateApi1 internalApi2 internal Verbose flagsMutex alignMutex cntMutex incMutex tas spinsLock conflictsLock modesLock detectLock maxLock max lockersLock max objectsLock partitionsLock timeoutLog bsize%#o %sLog file modeLog region maxLog sizeCache GBCache BCache max GBCache max BCache mmap sizeCache max open fdCache max writeCache numberCache max write sleepTxn maxTxn timestampTxn timeoutThread countRegistryRegistry offset Public environment flagsDB_ENVENV handle mutexHome Open flagsModePid cacheLockfhpLockerInternal recovery tableNumber of recovery table slotsExternal recovery tableThread hash bucketsThread hash tableMutex initial countMutex initial maxENV list of DB handles mutexDB reference countXA RM IDMT mutexCrypto handleLock handleLog handleCache handleMutex handleReplication handleTxn handleUser copyTest abortTest checkTest copy Private environment flagsPrimaryPer region database environment information:%s Region:Region IDSegment IDSize Initialization flagsRegion slots Replication flags%.24s Operation timestamp%.24s Replication timestampactiveblockedblocked and deadoutunknownThread tracking informationThread blocks allocatedThread allocation thresholdThread status blocks: process/thread %s: %s pins: %luEnvironment file handle informationfile-handle.file namefile-handle.mutexfile-handle.reference countfile-handle.file descriptorfile-handle.page numberfile-handle.page sizefile-handle.page offsetfile-handle.seek countfile-handle.read countfile-handle.write count file-handle.flagsID%x%luM %s (%lu)%luM %s (%d%%) (%d%% %s)0%luGB%s%luMB%s%luKB%s%luB%s REGINFO information:Region typeRegion nameOriginal region addressRegion addressRegion primary addressRegion maximum allocationRegion allocated Region flagsEnvironmentLockLogMpoolMutexTransactionInvalidUnknownREGION_CREATEREGION_CREATE_OKREGION_JOIN_OKDB_FH_NOSYNCDB_FH_OPENEDDB_FH_UNLINKDB_CREATEDB_FORCEDB_INIT_CDBDB_INIT_LOCKDB_INIT_LOGDB_INIT_MPOOLDB_INIT_REPDB_INIT_TXNDB_LOCKDOWNDB_NOMMAPDB_PRIVATEDB_RDONLYDB_RECOVERDB_RECOVER_FATALDB_SYSTEM_MEMDB_THREADDB_TRUNCATEDB_TXN_NOSYNCDB_USE_ENVIRONDB_USE_ENVIRON_ROOTENV_CDBENV_DBLOCALENV_LOCKDOWNENV_NO_OUTPUT_SETENV_OPEN_CALLEDENV_PRIVATEENV_RECOVER_FATALENV_REF_COUNTEDENV_SYSTEM_MEMENV_THREADDB_REGENV_REPLOCKEDDB_VERB_DEADLOCKDB_VERB_FILEOPSDB_VERB_FILEOPS_ALLDB_VERB_RECOVERYDB_VERB_REGISTERDB_VERB_REPLICATIONDB_VERB_REP_ELECTDB_VERB_REP_LEASEDB_VERB_REP_MISCDB_VERB_REP_MSGSDB_VERB_REP_SYNCDB_VERB_REPMGR_CONNFAILDB_VERB_REPMGR_MISCDB_VERB_WAITSFORDB_ENV_AUTO_COMMITDB_ENV_CDB_ALLDBDB_ENV_DIRECT_DBDB_ENV_DSYNC_DBDB_ENV_MULTIVERSIONDB_ENV_NOLOCKINGDB_ENV_NOMMAPDB_ENV_NOPANICDB_ENV_OVERWRITEDB_ENV_REGION_INITDB_ENV_RPCCLIENTDB_ENV_RPCCLIENT_GIVENDB_ENV_TIME_NOTGRANTEDDB_ENV_TXN_NOSYNCDB_ENV_TXN_NOWAITDB_ENV_TXN_SNAPSHOTDB_ENV_TXN_WRITE_NOSYNCDB_ENV_YIELDCPU__fop_file_setup: Retry limit (%d) exceededTransactional create on replication client disallowed%s%s: unexpected file type or formatrename: file %s existsmac derivation key magic valueUnencrypted checksum with a supplied encryption keyEncrypted checksum: no encryption key specifiedunable to allocate log region memoryFinding last valid log LSN: file: %lu offset %lu.%slog.Invalid log file: %signoring log file: %slog record size mismatchlog record checksum mismatchIgnoring log file: %s: magic number %lx, not %lxUnacceptable log file %s: unsupported log version %luSkipping log file %s: historic log version %luWarning: truncating to point beyond end of logIn-memory log buffer is full (an active transaction spans the buffer)DB_ENV->log_archiveno absolute path for the current directory__log_archivelog file auto-removeDB_ENV->log_archive: bad log recordDB_ENV->log_archive: unable to read log record/unknownfile %s has LSN %lu/%lu, past end of log at %lu/%lu%sCommonly caused by moving a database from one database environmentto another without clearing the database LSNs, or by removing all ofthe log files from a database environmentDB_ENV->log_printfLogging not currently permittedDIAGNOSTICDB_ENV->log_cursorDB_LOGC->closeDB_LOGC->versionDB_LOGC->get: unset cursorDB_LOGC->get: invalid LSN: %lu/%luDB_LOGC->get__logc_get_intEncountered zero length records while traversing backwardsDB_LOGC->get: log record LSN %lu/%lu: checksum mismatchDB_LOGC->get: catastrophic recovery may be requiredDB_LOGC->get: LSN %lu/%lu: invalid log record header__log_name failedDB_LOGC->get: %sDB_LOGC->get: LSN: %lu/%lu: readDB_LOGC->get: LSN: %lu/%lu: short readlog_rep_split: Processing LSN [%lu][%lu]log_rep_split: p %#lx ep %#lx logrec data %#lx, size %lu (%#lx)log_split: rep_apply ret %d, tmp_lsn [%lu][%lu]DB_ENV->get_lg_bsizeDB_ENV->set_lg_bsizeDB_ENV->get_lg_filemodeDB_ENV->set_lg_filemodeDB_ENV->get_lg_maxDB_ENV->set_lg_maxDB_ENV->get_lg_regionmaxDB_ENV->set_lg_regionmaxlog region size must be >= %dDB_ENV->log_get_configDB_ENV->log_set_configDB_ENV->log_set_config: direct I/O either not configured or not supportedDB_ENV->log_set_config: DB_LOG_IN_MEMORYin-memory log buffer must be larger than the log file sizeDB_ENV->log_putDB_ENV->log_put is illegal on replication clients%s %sNon-replication DB_ENV handle attemptingto modify a replicated environmentDB_ENV->log_put: record larger than maximum file size (%lu > %lu)Short read while restoring logDB_ENV->log_flushDB_ENV->log_flush: LSN of %lu/%lu past current end-of-log of %lu/%lu%s %s %sDatabase environment corrupt; the wrong log files mayhave been removed or incompatible database files importedfrom another environmentDB_ENV->log_fileDB_ENV->log_file is illegal with in-memory logsDB_ENV->log_file: name buffer is too shortDB_ENV->log_newfh: %lulog.%010d%s: log file unreadable%s: log file open failedlog.%05dDB_ENV->log_statDB_ENV->log_stat_printDefault logging region information:%#lx %sLog magic number%lu %sLog version numberLog record cache size%#o Log file mode%luMb Current log file size%luKb Current log file size%lu Current log file sizeRecords entered into the logLog bytes writtenLog bytes written since last checkpointTotal log file I/O writesTotal log file I/O writes due to overflowTotal log file flushesTotal log file I/O readsCurrent log file numberCurrent log file offsetOn-disk log file numberOn-disk log file offsetMaximum commits in a log flushMinimum commits in a log flushLog region sizeThe number of region locks that required waitingLog%sDB_LOG handle information:DB_LOG handle mutexLog file nameLog file handle FlagsLOG handle information:LOG region mutexFile name list mutexpersist.magicpersist.versionpersist.log_size%#lo %slog file permissions mode%lu/%lu %scurrent file offset LSNfirst buffer byte LSNcurrent buffer offsetcurrent file write offsetlength of last record%ld %slog flush in progressLog flush mutexlast sync LSNcached checkpoint LSNlog buffer sizelog file sizenext log file sizetransactions waiting to commitLSN of first commitDBLOG_RECOVERDBLOG_FORCE_OPENDBLOG_AUTOREMOVEDBLOG_DIRECTDBLOG_DSYNCDBLOG_INMEMORYDBLOG_OPENFILESDBLOG_ZERO/unable to allocate space from the buffer cacheunable to create temporary backing file%s: write failed for page %lupginpgout%s: %s failed for page %luDB_MPOOLFILE->getmemp_fget%s: dirty flag set for readonly file page%s: page %lu: reference count overflowFile %s: freeing pinned buffer for page %lu%s: file limited to %lu pagesDB_ENV->memp_fcreateDB_MPOOLFILE->set_clear_lenget_fileid: file ID not setDB_MPOOLFILE->set_fileidDB_MPOOLFILE->set_flagsDB_MPOOLFILE->set_ftypeDB_MPOOLFILE->set_lsn_offsetDB_MPOOLFILE->set_pgcookieDB_MPOOLFILE->get_priority: unknown priority value: %dDB_MPOOLFILE->set_priority: unknown priority value: %dunknownDB_MPOOLFILE->openDB_MPOOLFILE->open: page sizes must be a power-of-2DB_MPOOLFILE->open: clear length larger than page sizeDB_MPOOLFILE->open: temporary files can't be readonlyDB_MPOOLFILE->open: DB_MULTIVERSION requires transactions%s%s: file size not a multiple of the pagesize%s: clear length, page size or LSN location changedCannot open DURABLE and NOT DURABLE handles in the same fileDB_MPOOLFILE->close%s: close: %lu blocks left pinnedDB_MPOOLFILE->put%s: page %lu: unpinned page returned__memp_fput: pinned buffer not found for thread %s%s: dirty flag set for readonly file page%s: error getting a page for writing%s: error releasing a read-only pageDB_ENV->get_cachesizeindividual cache size too large: maximum is 4GBindividual cache size too large: maximum is 10TBDB_ENV->memp_set_configDB_ENV->memp_get_configDB_ENV->get_mp_max_openfdDB_ENV->set_mp_max_openfdDB_ENV->get_mp_max_writeDB_ENV->get_mp_max_mmapsizeTruncate beyond the end of file%s: non-transactional update to a multiversion file__db.freezer.%lu.%lu.%luK__memp_bh_freeze__memp_bh_thawUnable to allocate memory for mpool regionDB_ENV->memp_registercannot remove the last cachecannot resize to %lu cache regions: maximum is %luDB_ENV->get_mp_max_ncacheDB_ENV->set_cache_maxDB_ENV->memp_statDB_ENV->memp_stat_printDefault cache region information:Total cache sizeNumber of cachesMaximum number of cachesPool individual cache sizeMaximum memory-mapped file size%ld %sMaximum open file descriptorsMaximum sequential buffer writesSleep after writing maximum sequential buffersRequested pages mapped into the process' address spaceRequested pages found in the cacheRequested pages not found in the cachePages created in the cachePages read into the cachePages written from the cache to the backing fileClean pages forced from the cacheDirty pages forced from the cacheDirty pages written by trickle-sync threadCurrent total page countCurrent clean page countCurrent dirty page countNumber of hash buckets used for page locationTotal number of times hash chains searched for a pageThe longest hash chain searched for a pageTotal number of hash chain entries checked for pageThe number of hash bucket locks that required waitingThe maximum number of times any hash bucket lock was waited forThe number of region locks that required waitingThe number of buffers frozenThe number of buffers thawedThe number of frozen buffers freedThe number of page allocationsThe number of hash buckets examined during allocationsThe maximum number of hash buckets examined for an allocationThe number of pages examined during allocationsThe max number of pages examined for an allocationThreads waited on page I/O%sPool File: %sPage sizeMpoolMPOOL structure:MPOOL region mutex%lu/%lu %sMaximum checkpoint LSN%lu %sHash table entriesHash table last-checkedHash table LRU countPut counterDB_MPOOL handle information:DB_MPOOL handle mutexUnderlying cache regionsDB_MPOOLFILE structures:readonlyread/writeFile #%lu: %s: per-process, %sReference countPinned block reference countClear length IDFile typeLSN offsetMax gbytesMax bytesCache priority%#lx %smmap addressmmap length FlagsFile handleMPOOLFILE structures:Cache #%d:File #%d: %sMutexBlock countLast page numberOriginal last page numberMaximum page numberTypePriorityPage's LSN offsetPage's clear lengthBH hash table (%lu hash slots)bucket #: priority, I/O wait, [mutex] pageno, file, ref, LSN, address, priority, flagsbucket %lu: %lu (%lu dirty)(MVCC %lu/%lu/%lu) next: %5lu, %lu, %5lu, #%d, (sync-lock)%2lu%s, %lu/%lu (@%lu/%lu), %#08lx, %lu ()callpgindirtycreateddiscardfreedfrozenlockedtrashMP_CAN_MMAPMP_DIRECTMP_EXTENTdeadfilefile writtenno backing fileunlink on closenot durableMP_TEMPDB_MPOOL_NOFILEDB_MPOOL_UNLINKmemp_syncDB_MPOOLFILE->syncmemp_sync: correcting dirty count %lu %lu%s: unable to flush page: %lu%s: unable to flushmemp_trickleDB_ENV->memp_trickle: %d: percent must be between 1 and 100malloc: %luuser-specified malloc function returned NULLrealloc: %luUser-specified realloc function returned NULLclock_gettime%sfileops: directory list %s%s/%sstat: %sacquirereleasefileops: flock %s %s offset %lufcntlfileops: flush %sfsync%s: buffer too small to hold environment variable %sfcntl(F_SETFD)fileops: close %scloseno base system shared memory ID specifiedshmget: key: %ld: shared system memory region already existsshmget: key: %ld: unable to create shared system memory regionshmat: id %d: unable to attach to shared system memory regionshmctl/SHM_LOCK: id %d: unable to lock down shared memory region%sshmdtshmctl: id %d: unable to delete system shared memory regionmunmapfileops: munmapfileops: mmap %smmapmlockfileops: mkdir %sfileops: open %s__os_openfileops: rename %s to %srename %s %s/fileops: read %s: %lu bytes at offset %lufileops: write %s: %lu bytes at offset %lufileops: read %s: %lu bytesread: %#lx, %lufileops: write %s: %lu byteswrite: %#lx, %lufileops: seek %s to %luseek: %lu: (%lu * %lu) + %lufileops: stat %sfstatTMPDIRTEMPTMPTempFolder/var/tmp/usr/tmp/tmpfileops: truncate %s to %luftruncate: %lufileops: unlink %sunlink: %sselectDB_SEQUENCE->statDB_SEQUENCE->stat_printdecrementincrementrange set (internal)wraparound at endThe number of sequence locks that required waiting%lld %sThe current sequence value%sThe cached sequence valueThe last cached sequence valueThe minimum sequence valueThe maximum sequence value%lu %sThe cache size Sequence flagsdb_sequence_createDB_SEQUENCE->openZero length sequence key specifiedSequences not supported in databases configured for duplicate dataDB_SEQUENCE->open: DB_THREAD not supported with RPCSequence value out of rangeSequence create failedBad sequence record formatUnsupported sequence version: %dDB_SEQUENCE->get_cachesizeCache size must be >= 0DB_SEQUENCE->get_flagsDB_SEQUENCE->set_flagsDB_SEQUENCE->initial_valueDB_SEQUENCE->get_rangeDB_SEQUENCE->set_rangeMinimum sequence value must be less than maximum sequence valueSequence overflowSequence update failedDB_SEQUENCE->getSequence delta must be greater than 0Sequence with non-zero cache may not specify transaction handleDB_SEQUENCE->get_keyDB_SEQUENCE->closeDB_SEQUENCE->removeNumber of items to be cached is larger than the sequence rangetxn_beginChild transaction snapshot setting must match parentoperation not permitted during recoveryUnable to allocate memory for transaction detailDB_TXN->commitDB_TXN->prepare: log_write failedUnable to allocate memory for transaction nameDB_TXN->set_timeouttransaction has active cursorsnot a restored transactionPrepare disallowed on child transactionstransaction already preparedcommittedabortedtransaction already %sDB_TXN->abort: in-memory log undo failedDB_TXN->abort: log undo failed for LSN: %lu %luChild transaction is activetxn_checkpointtxn_checkpoint: failed to flush the buffer cachetxn_checkpoint: log failed at LSN [%ld %ld]Transaction has in memory logsAborting txn %#lx: %sTransaction abort failedDB_ENV->get_tx_maxDB_ENV->set_tx_maxDB_ENV->set_tx_timestamptxnid %lx commit record found, already on commit listtransaction not in list %lxTransaction not in list %xtxn_recoveroperation not permitted while in recoveryDB_ENV->txn_recoverInvalid checkpoint record at [%lu][%lu]No log recordsUnable to allocate memory for the transaction regionunable to discard txn %#lxunable to abort transaction %#lxError: closing the transaction region with active transactionstxn_id_setCurrent ID value %lu below minimumMaximum ID value %lu below minimumDB_ENV->txn_statDB_ENV->txn_stat_printDefault transaction region information:No checkpoint LSNFile/offset for last checkpoint LSN%lu/%lu %s0 No checkpoint timestamp%.24s Checkpoint timestamp%#lx Last transaction ID allocatedMaximum number of active transactions configuredActive transactionsMaximum active transactionsNumber of transactions begunNumber of transactions abortedNumber of transactions committedSnapshot transactionsMaximum snapshot transactionsNumber of transactions restoredTransaction region sizeThe number of region locks that required waitingActive transactions: %lx: %s; pid/thread %s; begin LSN: file/offset %lu/%lu; parent: %lx; read LSN: %lu/%lu; mvcc refcount: %lu; "%s"%sTransactionDB_TXNMGR handle information:DB_TXNMGR mutexNumber of transactions discardedDB_TXNREGION handle information:DB_TXNREGION region mutex%lu %sMaximum number of active txns%#lx %sLast transaction ID allocatedCurrent maximum unused IDcheckpoint mutexLast checkpoint LSN0%.24s Last checkpoint timestamp FlagsXA information:%ld %sXA RMIDabortedcommittedpreparedrunningXA abortedXA deadlockedXA endedXA preparedXA startedXA suspendedunknown state GID/XID:%#lx TXN_IN_RECOVERYtransaction handles should not be directly specified to XA interfacesno XA transaction declared55XZdZpZ|ZZZZZ Z@Zaaaaa a@aaaa b̜ܜ  4D@Tdt@̝ $L\ @, 8@Pdp| @(4 DT @8DTd x@   , @  P @` p |     @      0  @ @P ` t      Th000011(141 @1@L1\1h1x1111111 111122(2<2D2P2`2 t2@222222223303 D3X3l3333@33 334$484H4 \4@p4444444 4@5$585P5@FFFFGFG G@F0G8YDYLYTY\Y dY@lYtY|YYYY Y@YYYYYZ<`H`T`l`8oBerkeley DBx*+D-0p6135T89DUU  DQz & U X!l oGCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Buildroot 2012.02) 4.5.3A*aeabi 7-A A ,.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes X%  & &TzzU! ll * X!3.29554?DQDQETQTQXMooWpcpopt  pxyd,0Mp+