ELF(4@4 (uu 4 000Qtda}JchzT^ YsNp,y`lnDbZve$k(Pxf9jg'Bt->U1<[.Vi|W5r\{8qX4/HAR)w ! &# 237+:=%;ELK G?0C IM@]_SO"ad6*QoFmu Zt[H<`e\a(R0nQ"PU eXx^m ^T74g_4Tix;@[( "j4Rh(S%PST'T$HJh[ qogaPt#x)mTH" T T`|ZT  S\64^4:lO0i$Y U{T (S:$THq(T/OdbX8dy`4[h!#T,h8cpegT\U IlT"t^$+` SHB4d\D_$}QR@^hGO@i 'eXW0P,($///eSZ]W@-p@`P03/P@0T@-@v 0T  B\ 0 l !@ \G-`LP㐠` pp_PqP@0eS `QPa KPac P P P P//0 S5000/R@-P@` 2/pP6/P0W SP SPP10CB>A>A0BPcPP2G-@p`0Q RP Ua Ux U  Q Q R Q Q ^QQ`QQp PU @ Tv?  Qp0PUP\g Yc?P?   QQ X\TP\P@\L` VH?P?@?  Q> @ @Q@Q@T Q Q *6;A S(*0S # @ @Q@Q@T Q Q6;A S*0S  4#7 CP;!#TbO-DMAP`p @?~XW 00 00#X00S ZU3;/p;X U   (0#S 0 xS  ` `PU h  l  0V0V0S V V U $  ,`DЍp_$)QA-0P@p CTa Q`: S0;0P 00c00U0P U E#?P\-\"-0 0PU Ec?E? 0 ,, 00EY?0^%^P? ,, <<0]O-lM |o吐o$@*P`@dPvj@0\00X0Q 0`RS 3/> @p 0`40>080>0<0<V P 0SS `0d S 0AS9 `d dP(d` 0d 3$ QU  $P1d3/P Td -0 0 P`00S `QxxTd 0X=0` d0`0P  R   0u03q0S `T= 0, Y  9/PP0U0W0SpzP 0 S  <V00  R  T@ 0<, YP  9/PP0U0W0S0p0SC d0d\ X```0 7@P:>U8 /Ud0` R1<U` Z &U   0p\  0}P U  0uPNd`  `R0?SR8 R40P 8/pP`0 d`8?P F>P d `0 S S-R  S-R S-R  0>P XP``d\00 8/p`  0W0T0S ` d dPPT` Y?D4P E>T`` <FP  0P XP`d \0 0 8/p@``W`U@`VdbPPT`|Y  9/PP0U0W0Sp\0?SG>P`0d S S?R  0P XP``d\ 8/p`n T`` W00SodPPT``Y  9/VP WpV  R 03/!SJX``d\  >P &P  0p;  0\P5 8/p`"`0 T`` W00S"dPPT`,h`Y  9/ P WpV 0S 1/3/S3T  P  `%`   8/X`>PpY P  9/PWp0U00S  2/0W0T0S ` lPT`|P< @jPPT` @HaPP`@0LD0X0 0T H0Pp( p,00 `VP/U?U @p8/>P0 ` <U`p>U T0"U'UPT00L0 3&T  0p@  ( ,0xPT& 8/p@P=T/T >T?T &T  0p@  ( ,0UP 8/p@L0 T%P 8/@tW P=TQ 8/p@K PP &P  0pe 00 P_ 8/pP$@D@P00L0P=U/U >U &U  0pP@  0 0P9 8/pPL0 TP /U?U`$T p! X@p8/>P0 P >U 8/pP@pTPu7pTP,\C$e4It9h ?UP `8d v _aY  9/W pu; /U 0S 1/Y  9/ ?P Wp@ @d0`0&V X 0p 0 RR P`d \0HP! X8/p``dTT00 R RT 0S ! d7@@lЍP0'T"TDPL0 O-@SpPp` 0Ss S S  0P0P0S P P PPPP0S p 0S`?cVA0Spx 0Supo 0Sn`?c?7cV' V d0S`p`[ 0SWpp`R 0SNpH 0SG`?c?p?ccV?#d` 0V0V0S V V6;F S-*pPmTid 0V0V0S V V tU6;F S*UPRT7+E3Rk[&f%kh``J8@-@P PH0S S *0P 0P 00888O-@|TpP R:P0 `R0 R R  0V0V0S V V V  S:P0 R0V  S:P0 R0 R S:P0 00S`? cVZ R$ S:P0 0R S:tP0 00S`?c? 7cV5 V R S:YP0 0R S:LP0p 0R S:?Px0 00Sr`?c?p? ccVjA S:'P`0 0d V V R V V,6+F RQ* S:PI0 PS0:P?0 0T0 S:P30 0d V V R V V !!6+F R* S:P0 PS0:P 0 0T7+E3R[k%[&fh`FA-P@`"P'P&2/Ppե%P &6/PP;6/PP P6/P6/PP@-@P`ypP &5/PP;5/PV5/PPO-pԥEM`P0 8A<Sf)G0p@S<4/PVp0?S X VP @ OP 4/P?P hP5z0 p 0=sP m1S R 4/P 4/P >P 0S =4/P"4/P bP"4/P 0 0C 0 0pS0SG >4/P 0@p0  ]pPZ00?S!S  0p@p<4/P/4/P P>4/Ppp@p 0!00!S?S>4/P 4/P/4/P>4/P 0@tp|0S 1SW 4/Ppn 4/Php   P>Y0S 1SW 4/PpL 4/PFp0!r P70SWژ1SW 4/Pp) 4/P#p Pbp1S 3/`P  wP  PNpKpTpEߍ@@-*pp@-@Pp0 `SP  ePP U:`pp8@-@ P0R:P0@088-MMDʍ<00  0RЍڍ9H0@-0 0C9@-, 0 0 04Ѝ@9@-MM@p`0* xP@ @0P0`0  P0PP P {Ѝڍ8@-`\P@pwP0P P0PP PX8@E-@M`PpW0 0Pl0 @P0PP  0 S` 0# 30F% 5dЍ7Ԝ@-MMP* 0`P @@?P @ p@P  0Ѝڍ@-MMH@ʍ@0 0 000Ѝڍ6H@-0000 0wL6@-.0000 0hЍ68@-@PAQ8@-@@@-@A8@-P<008@T8P P85P/ R/R/0S/Q/P/0S/P/0S/P/ R/R/0S/Q/P/0S/P/P/ R/R/0S/Q/P /P/P 0S/S0S R///PQ0SQ00S 0S RQ  Q00/P/P,/p@-@P`,PpQpPp@O-P`0 @pp W 0 P@DT0 JPW0!!W0!P0!  DV`Yp@-@QP` PpU p@p@-@PP 0S @0P/ R /G-@Pp0R0\0SSRQGXM `VH! 7P0_ P 1P`EaPEU0  0`FP 0 00`0fSQ0  `0P00 `PV V 01xP 0 0 00 0P/O-pPxP`W @P`M <1HU UY004 000*RQ @P0 @P `"Q @000  000000 0[ R  BP0 4!0S 3/,0 (0, Ѝۍ@Ѝ/( @-CM`@P 0P3P pPP  0Cߍ-@-@Ѝ/ -LUnable to allocate memory for attribute '%s' in element %s!Unable to add entity callback!ampltgtquotAEligAacuteAcircAgraveAlphaAringAtildeAumlBetaCcedilChiDaggerDeltaDstrokETHEacuteEcircEgraveEpsilonEtaEumlGammaIacuteIcircIgraveIotaIumlKappaLambdaMuNtildeNuOEligOacuteOcircOgraveOmegaOmicronOslashOtildeOumlPhiPiPrimePsiRhoScaronSigmaTHORNTauThetaUacuteUcircUgraveUpsilonUumlXiYacuteYumlZetaaacuteacircaeligagravealefsymalphaandaposaringasympatildeaumlbdquobetabrkbarbrvbarbullcapccedilcentchiclubscongcopycrarrcupcurrendArrdaggerdarrdegdeltadiamsdiedivideeacuteecircegraveemptyemspenspepsilonequivetheumleuroexistfnofforallfrac12frac14frac34fraslgammahArrharrheartshelliphibariacuteicirciexcligraveimageinfinintiotaiquestisiniumlkappalArrlambdalanglaquolarrlceilldquolelfloorlowastlozlrmlsaquolsquomacrmdashmicromiddotminusmunablanbspndashninotnotinnsubntildenuoacuteocircoeligograveolineomegaomicronoplusordfordmoslashotildeotimesoumlparapartpermilperpphipipivplusmnpoundprimeprodproppsirArrradicrangraquorceilrdquorealregrfloorrhorlmrsaquorsquosbquoscaronsdotsectshysigmasigmafsimspadessubesumsupsup1sup2sup3supeszligtauthere4thetathetasymthinspthorntradeuArruacuteuarrucircugraveupsihupsilonuumlweierpxiyacuteyenyumlzetazwjzwnjBad control character 0x%02x not allowed by XML standard!Invalid UTF-8 sequence for character 0x%04x!nullEntity name too long under parent <%s>!Character entity "%s" not terminated under parent <%s>!Entity name "%s;" not supported under parent <%s>!Bad control character 0x%02x under parent <%s> not allowed by XML standard!Unable to expand string buffer to %d bytes!integer(null)Unable to allocate string buffer!Bad custom value '%s' in parent <%s>!Bad %s value '%s' in parent <%s>!Unable to add value node of type %s to parent <%s>!Bare < in element!!--![CDATA[Early EOF in comment node!<%s> cannot be a second root node after <%s>Unable to add comment node to parent <%s>!Early EOF in CDATA node!Unable to add CDATA node to parent <%s>!Early EOF in processing instruction node!Unable to add processing instruction node to parent <%s>!Early EOF in declaration node!Unable to add declaration node to parent <%s>!Mismatched close tag <%s> under parent <%s>!Unable to add element node to parent <%s>!Unable to allocate memory for name!Unable to allocate memory for value!Expected '>' after '%c' for element %s, but got '%c'!Bare < in element %s!Missing value for attribute '%s' in element %s!Expected > but got '%c' instead for element <%s/>!Missing close tag under parent <%s>!%d%fMXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOMUnable to allocate %d bytes for index - %sUnable to allocate %d bytes for index: %s![CDATA[%s]]1.0?xml version="%s" encoding="utf-8"?*/mxml: %s gjjpjwj}jjjjjjjjj! jjjjjjjjjjjjjkk kkkk$k'kR-k4k:kAkGkOkVk]kbkfkik3 okskwk`~kkkkkkkkkkkkxkkkqjkkk5!k[j&k'"um "k'klH"l ll ll$l+l" 0l)"4lj;l@lxjDlc&JlE"OlTl!Zl*"^lel!jl ql!vlzllf&llllll"l l lla"jlll l"ll"llllD l?me"bj>m! m!me&m& m"m)m/m5m $n*n2n"m("8n=nBnInPn"Wn\nan"fn0 mn"rnvnyn}nnn2 n"n"nej"n!n"n*#nUl!n #n n!nn #nn n: n n nan"nnoo o<"o`&m"o"o"!o"%o*o/o4o"9o?oCo4"JoPoYo `ojQnfo"!lo!qoxo!}oojoooo!oooooo o tt uu!u+u O\  i 4 m to 0 GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Buildroot 2012.02) 4.5.3A*aeabi 7-A A ,.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes  44  m! tt* 3.9pJ?iiE2jj MuuWco t 00  0Mpa+